DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACOX1 and CG9547

DIOPT Version :9

Sequence 1:NP_004026.2 Gene:ACOX1 / 51 HGNCID:119 Length:660 Species:Homo sapiens
Sequence 2:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster


Alignment Length:356 Identity:80/356 - (22%)
Similarity:126/356 - (35%) Gaps:93/356 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   118 EQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGLGK 182
            ||::|:.......::||.:..||..||:...|:||.|.||.:::.:|||..     |.|      
  Fly   140 EQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILNGS-----KTW------ 193

Human   183 TSNHAIVLAQLITKGKCYG--LHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNH 245
             ...|.:...::...||..  :..|:|..:..|     .|:....|..||.......|.:.||..
  Fly   194 -ITSAPIADVIVVWAKCEDGKVRGFLVDRKISG-----KGLETPKIEGKFSLRASPTGMILMDEV 252

Human   246 RIPRENMLMKYAQVKPDGTYVKPLS--NKLTYGTMVFVRSFLVGEAARALSKACT-IAIRYSAVR 307
            |:|.|.:|...|      .:..|.|  |...||         :...|...::.|. ||.:|:..|
  Fly   253 RVPEEQLLPNVA------GFSGPFSCLNNARYG---------IAWGALGAAETCVEIARQYTLDR 302

Human   308 HQSEIKPGEPEPQILDFQTQQYKLFPLLA-TAYAFQ---FVGAYMKETYHRINEGIGQGDLSELP 368
            .|.    |.|   :...|..|.||...:. .|...|   .||....:..|             .|
  Fly   303 KQF----GRP---LAANQLIQKKLADAITEIALGLQACLHVGRLKDQKLH-------------TP 347

Human   369 ELHALTAGLKAFTSWTANTG-----IEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMM 428
            ::.:|   ||     ..|||     ....|...|.:|.|....:....:|.....|:||.:    
  Fly   348 DMISL---LK-----RNNTGKSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTH---- 400

Human   429 LQTARFLMKSYDQVHS---GKLVCGMVSYLN 456
                        .:|:   |:.:.|:.::.|
  Fly   401 ------------DIHALILGRAITGLAAFAN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACOX1NP_004026.2 AXO 3..637 CDD:173839 80/356 (22%)
PLN02443 5..651 CDD:178062 80/356 (22%)
CG9547NP_609040.1 GCD 29..417 CDD:173840 79/352 (22%)
CaiA 41..417 CDD:224871 79/352 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.