DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SHANK1 and ste4

DIOPT Version :10

Sequence 1:XP_011525315.1 Gene:SHANK1 / 50944 HGNCID:15474 Length:2169 Species:Homo sapiens
Sequence 2:NP_593283.1 Gene:ste4 / 2541677 PomBaseID:SPAC1565.04C Length:264 Species:Schizosaccharomyces pombe


Alignment Length:59 Identity:21/59 - (35%)
Similarity:33/59 - (55%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


Human  2106 WTKFDVADWLEWLGLAEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALK 2164
            |....|.:|:|.||. .|:..|.|:.|.|..:..|:..|..|:|:..||||::|..|::
pombe    11 WNNEAVCNWIEQLGF-PHKEAFEDYHILGKDIDLLSSNDLRDMGIESVGHRIDILSAIQ 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SHANK1XP_011525315.1 FERM_F0_SHANK1 70..158 CDD:340695
ANKYR 166..407 CDD:440430
ANK repeat 212..244 CDD:293786
ANK repeat 246..277 CDD:293786
ANK repeat 279..344 CDD:293786
ANK repeat 346..377 CDD:293786
SH3 557..608 CDD:473055
PDZ_SHANK1_3-like 656..757 CDD:467228
SAM_Shank1,2,3 2102..2167 CDD:188905 21/59 (36%)
ste4NP_593283.1 SAM_2 8..70 CDD:429573 21/59 (36%)
PRK03992 81..>125 CDD:179699
RA_STE50 168..262 CDD:340484
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.