DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCBP1 and ps

DIOPT Version :10

Sequence 1:NP_006187.2 Gene:PCBP1 / 5093 HGNCID:8647 Length:356 Species:Homo sapiens
Sequence 2:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster


Alignment Length:38 Identity:10/38 - (26%)
Similarity:18/38 - (47%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   148 ILVHCAVGVSRSATLVLAYLMLYHHFTLVEAIKKVKDH 185
            ||...|...::.|....|..:|:..:.:.:.:||..||
  Fly   107 ILGKVAEKTNQIAPAFAAATLLFEAYQISKEVKKDIDH 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCBP1NP_006187.2 KH-I_PCBP1_2_rpt1 13..82 CDD:411943
KH-I_PCBP1_2_rpt2 92..169 CDD:411946 5/20 (25%)
KH-I_PCBP1_2_rpt3 276..351 CDD:411949
psNP_001262415.1 KH-I_NOVA_rpt1 274..345 CDD:411863
KH-I_NOVA_rpt2 367..436 CDD:411864
KH-I_NOVA_rpt3 694..762 CDD:411807
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.