DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Olig1 and CG33557

DIOPT Version :9

Sequence 1:NP_058664.2 Gene:Olig1 / 50914 MGIID:1355334 Length:260 Species:Mus musculus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:129 Identity:45/129 - (34%)
Similarity:65/129 - (50%) Gaps:30/129 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 SSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQL--------------- 95
            ||||||.:..|:...|::      :...|.|..||.| ||:::.|..|:.               
  Fly     4 SSSSSSFSNYLMAVFAQD------SNSSGSASGSGAA-ADSEDSQIGQEANPGGQENQGNHRRRP 61

Mouse    96 -RRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQ 158
             |:|||:|||.|..::|.|.:|||.:| |....:      ||||||..:.||.:||..|.|:|:
  Fly    62 PRQKINARERYRTFNVNSAYEALRNLI-PTEPMN------RKLSKIEIIRLASSYITHLSSTLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Olig1NP_058664.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..104 22/73 (30%)
HLH 96..153 CDD:278439 25/56 (45%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.