DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NTM and opcml

DIOPT Version :9

Sequence 1:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:360 Identity:188/360 - (52%)
Similarity:247/360 - (68%) Gaps:30/360 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    12 ISWAIFTGLAALCLF---QGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRST 73
            :.|.....:|...||   .|||.||||:..   .||:|||||:||.|:|::||:|:|||||||:|
Zfish     9 LQWKCLVVVALRLLFLVPAGVPARSGDSYL---KDNITVRQGDSAVLKCSMDNKVSRVAWLNRTT 70

Human    74 ILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKI 138
            ||:.||:||.||||||||:....:|||:|.||::||||||.||:.|:..|::::|||||||..:|
Zfish    71 ILFTGNEKWSLDPRVVLLNTAVNEYSIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARI 135

Human   139 VEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSA 203
            |.:|:|:|:|||:|:||.|:|.|||||::.|:..|.|....|:|.||:|:.|||::.||.|:|..
Zfish   136 VNVSTDVSVNEGSNVSLMCLAIGRPEPSILWKFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCIT 200

Human   204 SNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKG 268
            |||::.|.||.|:|||||||.||.|:.||..|||||.|.|||||||.|:|||:|.::|::.|..|
Zfish   201 SNDISPPDVRTVQVTVNYPPVISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNG 265

Human   269 VKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALTPW 333
            ||:||:...|.|.||||||.|||||||||.|.||.|||||:|:                      
Zfish   266 VKIENKGKQSMLTFFNVSEEDYGNYTCVAINTLGITNASIILY---------------------- 308

Human   334 KGPGAVSEVSNGT-SRRAGCVWLLPLLVLHLLLKF 367
             ||||:.:|:|.. |.....:.|..||.|.||.||
Zfish   309 -GPGAIHDVNNAALSPTCSLLLLTLLLTLSLLSKF 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NTMNP_001338930.1 Ig 44..132 CDD:416386 54/87 (62%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 4/7 (57%)
CDR1 59..63 CDD:409353 2/3 (67%)
FR2 64..70 CDD:409353 4/5 (80%)
Ig strand C 64..70 CDD:409353 4/5 (80%)
CDR2 71..83 CDD:409353 7/11 (64%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 22/33 (67%)
Ig strand D 87..94 CDD:409353 5/6 (83%)
Ig strand E 97..103 CDD:409353 3/5 (60%)
Ig strand F 110..118 CDD:409353 6/7 (86%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 4/8 (50%)
FR4 125..132 CDD:409353 3/6 (50%)
Ig_3 136..205 CDD:404760 33/68 (49%)
Ig strand A' 142..147 CDD:409353 2/4 (50%)
Ig strand B 153..160 CDD:409353 3/6 (50%)
Ig strand C 166..171 CDD:409353 1/4 (25%)
Ig strand D 177..180 CDD:409353 0/2 (0%)
Ig strand E 184..190 CDD:409353 3/5 (60%)
Ig strand F 197..204 CDD:409353 3/6 (50%)
Ig strand G 211..219 CDD:409353 4/7 (57%)
Ig_3 222..299 CDD:404760 49/76 (64%)
putative Ig strand A 223..229 CDD:409353 3/5 (60%)
Ig strand B 239..243 CDD:409353 2/3 (67%)
Ig strand C 252..256 CDD:409353 2/3 (67%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 4/4 (100%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 54/87 (62%)
IG_like 41..129 CDD:214653 54/87 (62%)
IG_like 139..216 CDD:214653 39/76 (51%)
IGc2 146..202 CDD:197706 27/55 (49%)
I-set 219..307 CDD:254352 57/87 (66%)
ig 223..307 CDD:278476 54/83 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194332082
Domainoid 1 1.000 134 1.000 Domainoid score I20055
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 434 1.000 Inparanoid score I7406
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG43105
OrthoDB 1 1.010 - - D239899at7742
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm28147
orthoMCL 1 0.900 - - OOG6_104123
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.