DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NTM and rig-5

DIOPT Version :9

Sequence 1:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:359 Identity:97/359 - (27%)
Similarity:156/359 - (43%) Gaps:57/359 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     4 IQPKMHNSISWAIFTGLAALCLFQGVPVRSGDATFPK-AMDNVTVRQGESATLRCTIDNRVTR-V 66
            :|.||:   .:|:..|:  |.:|:....|....|..: :|.:.....|:.....|.:::..:. |
 Worm    57 LQEKMY---LFALLCGV--LLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMV 116

Human    67 AW---------LNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNH 122
            |:         |:....::...:|:.|.||:..|.|   ::.:.|:||...|.|.|:|.:.|:  
 Worm   117 AFVKADSPPRLLSFDEKVFRRRNKYELKPRIGDLHN---EWVLTIKNVQESDRGNYSCQINTE-- 176

Human   123 PKT-SRVHLIVQVSPKIVEISSD--ISINEGNNISLTCIATGRPEPTVTWRHISPK------AVG 178
            |.| |...|.|:| |.:|..|:.  :.:.||||:||||.|.|.|.|||.||....:      |.|
 Worm   177 PITLSTGELDVKV-PPVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATG 240

Human   179 F---VSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYI-SEAKGTGVPVGQKG 239
            |   |.....|.:..::|:...:|.|.|||.:.......||:.|.:||.: ::::.....||...
 Worm   241 FGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMA 305

Human   240 TLQCEASAVPSAEFQWYKDDKRLIEGKK------------GVKVENRPFLSKLIFFNVSEHDYGN 292
            .:.|...|.|..|..|.||.:.:.|...            .|.:        |...||....:|.
 Worm   306 RMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHI--------LEIRNVQSSHFGV 362

Human   293 YTCVASNKLG--HTNASIMLFELNEPTSSTLLQE 324
            |.|||.|..|  |:..::.....|..|:|.|:.|
 Worm   363 YRCVAKNDNGIHHSQVTLNQISHNHFTNSNLIPE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NTMNP_001338930.1 Ig 44..132 CDD:416386 23/98 (23%)
Ig strand A' 44..49 CDD:409353 0/4 (0%)
Ig strand B 51..59 CDD:409353 1/7 (14%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 2/15 (13%)
Ig strand C 64..70 CDD:409353 2/15 (13%)
CDR2 71..83 CDD:409353 1/11 (9%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 12/33 (36%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 4/9 (44%)
FR4 125..132 CDD:409353 3/7 (43%)
Ig_3 136..205 CDD:404760 28/79 (35%)
Ig strand A' 142..147 CDD:409353 1/6 (17%)
Ig strand B 153..160 CDD:409353 4/6 (67%)
Ig strand C 166..171 CDD:409353 3/4 (75%)
Ig strand D 177..180 CDD:409353 2/5 (40%)
Ig strand E 184..190 CDD:409353 1/5 (20%)
Ig strand F 197..204 CDD:409353 2/6 (33%)
Ig strand G 211..219 CDD:409353 2/7 (29%)
Ig_3 222..299 CDD:404760 21/89 (24%)
putative Ig strand A 223..229 CDD:409353 1/6 (17%)
Ig strand B 239..243 CDD:409353 0/3 (0%)
Ig strand C 252..256 CDD:409353 1/3 (33%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 24/101 (24%)
Ig_3 191..270 CDD:372822 27/78 (35%)
IG 294..380 CDD:214652 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161450905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I3823
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm15630
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.