DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F11R and f11r

DIOPT Version :10

Sequence 1:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens
Sequence 2:NP_001008022.1 Gene:f11r / 493384 XenbaseID:XB-GENE-5919168 Length:291 Species:Xenopus tropicalis


Alignment Length:329 Identity:122/329 - (37%)
Similarity:176/329 - (53%) Gaps:47/329 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     5 AQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAY-SGFSSPRVEWKFDQGD 68
            |...|..:.|.:|...|.:.|...|:  :..|.:.:.:.....|.|.| |.|:..||||||....
 Frog     4 ASSNRGAVVLGLLCACLWTAAFAGVS--TPNPTITVKQGATADLRCTYTSDFTKSRVEWKFVNNQ 66

Human    69 -TTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNS---YGEVKVKLIVL 129
             .|..|.|:..:||||.:|.|.:|.||....:|.:|.|.|:|.|:....|.   |||.|::|:|:
 Frog    67 LETFFVYYDGTLTASYVNRATSVPQGIILNQITSKDAGEYSCEVTSVDSNGQTLYGEAKIQLLVI 131

Human   130 VPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTT 194
            |.||:|..::|::...|:...|.|.|..|.||..:||:::...||.||:      |::|.::|.|
 Frog   132 VAPSQPMAHVPNTVRTGSAVELRCVETQGYPPPTFTWYQNKAPMPPNPQ------NATYTIDPNT 190

Human   195 GELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWF 259
            |.|.|..::|||:|:|.|:|.|..| ...|..|||...:.|||.|||||::.|::|.::.||:|:
 Frog   191 GVLKFRAVAASDSGDYYCKAANSEG-EQVSAIVRMNVQDVNVGGIVAAVVIVLLILALIGFGLWY 254

Human   260 AYSRGHFDKLGACPSIFPSHAVFCPADTHDPISSLSGTKKGTSSKKVIYSQPS-ARSEGEFKQTS 323
            |||||:.||.|                                :||||||||| .||:..|:|||
 Frog   255 AYSRGYLDKKG--------------------------------NKKVIYSQPSETRSDKNFQQTS 287

Human   324 SFLV 327
            ||||
 Frog   288 SFLV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 36/103 (35%)
FR1 30..52 CDD:409538 3/21 (14%)
Ig strand A 30..33 CDD:409538 0/2 (0%)
Ig strand A' 37..41 CDD:409538 0/3 (0%)
Ig strand B 44..53 CDD:409538 3/9 (33%)
CDR1 53..58 CDD:409538 2/4 (50%)
Ig strand C 58..66 CDD:409538 6/7 (86%)
FR2 59..66 CDD:409538 6/6 (100%)
CDR2 69..83 CDD:409538 5/13 (38%)
Ig strand C' 69..74 CDD:409538 1/4 (25%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 10/27 (37%)
Ig strand D 86..90 CDD:409538 2/3 (67%)
Ig strand E 92..96 CDD:409538 2/3 (67%)
Ig strand F 105..113 CDD:409538 4/7 (57%)
CDR3 113..119 CDD:409538 1/8 (13%)
Ig strand G 119..128 CDD:409538 5/8 (63%)
FR4 120..129 CDD:409538 4/8 (50%)
IgI_2_JAM1 135..231 CDD:409542 35/95 (37%)
Ig strand A 135..139 CDD:409542 1/3 (33%)
Ig strand A' 141..144 CDD:409542 0/2 (0%)
Ig strand B 147..155 CDD:409542 2/7 (29%)
Ig strand C 163..168 CDD:409542 2/4 (50%)
Ig strand C' 170..172 CDD:409542 0/1 (0%)
Ig strand D 187..191 CDD:409542 1/3 (33%)
Ig strand E 195..199 CDD:409542 2/3 (67%)
Ig strand F 208..214 CDD:409542 3/5 (60%)
Ig strand G 221..231 CDD:409542 4/9 (44%)
f11rNP_001008022.1 Ig 28..131 CDD:472250 37/104 (36%)
Ig strand B 43..47 CDD:409353 1/3 (33%)
Ig strand C 57..61 CDD:409353 3/3 (100%)
Ig strand E 91..95 CDD:409353 2/3 (67%)
Ig strand F 105..110 CDD:409353 2/4 (50%)
Ig strand G 123..126 CDD:409353 1/2 (50%)
Ig 137..226 CDD:472250 35/95 (37%)
Ig strand B 151..155 CDD:409353 1/3 (33%)
Ig strand C 165..169 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 2/3 (67%)
Ig strand F 205..210 CDD:409353 2/4 (50%)
Ig strand G 219..222 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.