DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment F11R and Tl

DIOPT Version :9

Sequence 1:	NP_001369656.1	Gene:	F11R / 50848	HGNCID:	14685	Length:	327	Species:	Homo sapiens
Sequence 2:	NP_001262995.1	Gene:	Tl / 43222	FlyBaseID:	FBgn0262473	Length:	1117	Species:	Drosophila melanogaster

Alignment Length:	36	Identity:	11/36 - (30%)
Similarity:	16/36 - (44%)	Gaps:	0/36 - (0%)

- Green bases have known domain annotations that are detailed below.

Human   260 AYSRGHFDKLGACPSIFPSHAVFCPADTHDPISSLS 295
            |.|....|.|..|..|...:.:.|||:..:|...|:
  Fly    33 ACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLT 68

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
F11R	NP_001369656.1	IgV_1_JAM1-like	30..129	CDD:409538
		Ig strand B	46..50	CDD:409538
		Ig strand C	59..63	CDD:409538
		Ig strand E	92..96	CDD:409538
		Ig strand F	106..111	CDD:409538
		Ig strand G	121..124	CDD:409538
		IgI_2_JAM1	135..231	CDD:409542
		Ig strand B	149..153	CDD:409542
		Ig strand C	163..167	CDD:409542
		Ig strand E	195..199	CDD:409542
		Ig strand F	209..214	CDD:409542
		Ig strand G	224..227	CDD:409542
Tl	NP_001262995.1	LRR_8	174..233	CDD:290566
		leucine-rich repeat	176..198	CDD:275380
		leucine-rich repeat	199..222	CDD:275380
		LRR_RI	216..542	CDD:238064
		LRR_8	221..281	CDD:290566
		leucine-rich repeat	223..270	CDD:275380
		leucine-rich repeat	271..294	CDD:275380
		leucine-rich repeat	295..320	CDD:275380
		leucine-rich repeat	321..343	CDD:275380
		LRR_8	342..402	CDD:290566
		leucine-rich repeat	344..367	CDD:275380
		leucine-rich repeat	368..391	CDD:275380
		LRR_8	390..450	CDD:290566
		leucine-rich repeat	392..415	CDD:275380
		leucine-rich repeat	416..439	CDD:275380
		leucine-rich repeat	440..474	CDD:275380
		leucine-rich repeat	475..498	CDD:275380
		LRR_8	477..534	CDD:290566
		leucine-rich repeat	499..520	CDD:275380
		leucine-rich repeat	523..552	CDD:275380
		LRRCT	561..619	CDD:214507
		LRRNT	631..667	CDD:214470
		leucine-rich repeat	664..693	CDD:275380
		LRR_8	669..726	CDD:290566
		leucine-rich repeat	694..715	CDD:275380
		leucine-rich repeat	716..737	CDD:275380
		LRRCT	751..800	CDD:214507
		TIR	858..996	CDD:214587
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910