DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F11R and beat-IIa

DIOPT Version :9

Sequence 1:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens
Sequence 2:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster


Alignment Length:389 Identity:78/389 - (20%)
Similarity:129/389 - (33%) Gaps:104/389 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    14 LFILAILLCSL-----ALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLV 73
            |.:|.:||.|:     ||.:|.:....|.||  ....|.|.|.|....:|....||.:|   :|.
  Fly    51 LLLLGVLLLSMELVECALRNVNLIIEPPAVR--RGQHVVLRCMYDLDGAPLYSAKFYRG---QLE 110

Human    74 CY--------NNKI---TASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGG--NSYGEVKVK 125
            .|        |.|:   ...:.|..:...|.:..::|....:|.::|.|:.:..  ::...|...
  Fly   111 FYRYTPGEFPNTKVFPFPGIHVDVSSSNATQVLLRNVGFGLSGNFSCEVTADAPLFSTATAVDTM 175

Human   126 LIVLVPPSKPTVNI------PSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMP---------- 174
            .:|.:|..:|.|..      |......|     ||.....|.:|.|:..:.:|:.          
  Fly   176 QVVELPEKRPQVFTEHTRYEPGDVLRAN-----CSTPPSRPRAELTFTINNMVITHVDTEYIRTI 235

Human   175 TNPKSTR-----------------AFSNSSYVLNPTTGE--LVFDPLSASDTGEYSCEARNG--- 217
            .|..:||                 |..|:.|.||...|.  .|:.|.|........|.|:.|   
  Fly   236 DNLIATRISLKMQLQGIHFSSVNPAIYNNVYGLNSVYGHGGPVYAPNSNPGGLLLRCSAQIGDLY 300

Human   218 -------YGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDKLGACPSI 275
                   .|||      :.:.|...|.:.....|...       |..:|:.|.....:|  .|.:
  Fly   301 QEYKEIELGTP------QKDPVPARVTLSSDTSLKNF-------FSSYFSTSASAASRL--LPGV 350

Human   276 FPS--------------HAVF--CPADTHDPISSLSGTKKGTSSKKVIYSQPSARSEGEFKQTS 323
            :.:              .|.|  |.|.:.||.|....:.:.:..::....:|:..|.....:.|
  Fly   351 YMAPLIMAMLASLFRLIEAAFEPCDASSQDPQSQTGHSMEHSKERREPKERPALVSSCSVSKAS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 22/111 (20%)
Ig strand B 46..50 CDD:409538 2/3 (67%)
Ig strand C 59..63 CDD:409538 0/3 (0%)
Ig strand E 92..96 CDD:409538 1/3 (33%)
Ig strand F 106..111 CDD:409538 1/4 (25%)
Ig strand G 121..124 CDD:409538 1/2 (50%)
IgI_2_JAM1 135..231 CDD:409542 28/140 (20%)
Ig strand B 149..153 CDD:409542 0/3 (0%)
Ig strand C 163..167 CDD:409542 2/3 (67%)
Ig strand E 195..199 CDD:409542 1/5 (20%)
Ig strand F 209..214 CDD:409542 1/4 (25%)
Ig strand G 224..227 CDD:409542 0/2 (0%)
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 7/51 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.