| Sequence 1: | NP_001369656.1 | Gene: | F11R / 50848 | HGNCID: | 14685 | Length: | 327 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001034052.2 | Gene: | side-IV / 41657 | FlyBaseID: | FBgn0038156 | Length: | 1001 | Species: | Drosophila melanogaster |
| Alignment Length: | 253 | Identity: | 55/253 - (21%) |
|---|---|---|---|
| Similarity: | 89/253 - (35%) | Gaps: | 79/253 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Human 91 PTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTV----------NIPSSATI 145
Human 146 GNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTG-- 208
Human 209 ----EYSCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDKL 269
Human 270 GACPSIFPSHAVFCPAD-THDPISSLSGTK--------KGTSSKKVI---YSQPSARS 315 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| F11R | NP_001369656.1 | IgV_1_JAM1-like | 30..129 | CDD:409538 | 9/37 (24%) |
| Ig strand B | 46..50 | CDD:409538 | |||
| Ig strand C | 59..63 | CDD:409538 | |||
| Ig strand E | 92..96 | CDD:409538 | 0/3 (0%) | ||
| Ig strand F | 106..111 | CDD:409538 | 2/4 (50%) | ||
| Ig strand G | 121..124 | CDD:409538 | 0/2 (0%) | ||
| IgI_2_JAM1 | 135..231 | CDD:409542 | 25/111 (23%) | ||
| Ig strand B | 149..153 | CDD:409542 | 2/3 (67%) | ||
| Ig strand C | 163..167 | CDD:409542 | 1/3 (33%) | ||
| Ig strand E | 195..199 | CDD:409542 | 1/3 (33%) | ||
| Ig strand F | 209..214 | CDD:409542 | 1/4 (25%) | ||
| Ig strand G | 224..227 | CDD:409542 | 0/2 (0%) | ||
| side-IV | NP_001034052.2 | V-set | 79..188 | CDD:284989 | 9/36 (25%) |
| IG_like | 80..188 | CDD:214653 | 9/36 (25%) | ||
| Ig | 210..281 | CDD:299845 | 20/84 (24%) | ||
| Ig | 319..392 | CDD:299845 | 8/35 (23%) | ||
| IG_like | 319..383 | CDD:214653 | 8/35 (23%) | ||
| IG_like | 412..489 | CDD:214653 | |||
| IGc2 | 413..478 | CDD:197706 | |||
| Ig_3 | 509..572 | CDD:290638 | |||
| fn3 | 593..675 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||