| Sequence 1: | NP_001369656.1 | Gene: | F11R / 50848 | HGNCID: | 14685 | Length: | 327 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262432.1 | Gene: | side-VII / 41184 | FlyBaseID: | FBgn0037736 | Length: | 939 | Species: | Drosophila melanogaster |
| Alignment Length: | 296 | Identity: | 70/296 - (23%) |
|---|---|---|---|
| Similarity: | 107/296 - (36%) | Gaps: | 85/296 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Human 10 KLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSC---AYSGFSSPRVEWKFDQGDTTR 71
Human 72 LVCYNNKITAS-------------YEDRVTFL----PTGITFKSVTREDTGTYTCMV---SEEGG 116
Human 117 NSYGEVKVKLIVLVPPSKPTV----NIPSSATI-----GNRAVLTCSEQDGSPPSEYTWFKDGIV 172
Human 173 MP----------------TNPKSTRAFSNS-------SYVLNPTTGELV---------------- 198
Human 199 FDPLSASDTGEYSCEARNGYGTPMT----SNAVRME 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| F11R | NP_001369656.1 | IgV_1_JAM1-like | 30..129 | CDD:409538 | 28/121 (23%) |
| Ig strand B | 46..50 | CDD:409538 | 1/3 (33%) | ||
| Ig strand C | 59..63 | CDD:409538 | 1/3 (33%) | ||
| Ig strand E | 92..96 | CDD:409538 | 0/3 (0%) | ||
| Ig strand F | 106..111 | CDD:409538 | 3/4 (75%) | ||
| Ig strand G | 121..124 | CDD:409538 | 0/2 (0%) | ||
| IgI_2_JAM1 | 135..231 | CDD:409542 | 30/148 (20%) | ||
| Ig strand B | 149..153 | CDD:409542 | 1/3 (33%) | ||
| Ig strand C | 163..167 | CDD:409542 | 0/3 (0%) | ||
| Ig strand E | 195..199 | CDD:409542 | 1/19 (5%) | ||
| Ig strand F | 209..214 | CDD:409542 | 1/4 (25%) | ||
| Ig strand G | 224..227 | CDD:409542 | 1/2 (50%) | ||
| side-VII | NP_001262432.1 | IG_like | 32..134 | CDD:214653 | 26/110 (24%) |
| V-set | 32..134 | CDD:284989 | 26/110 (24%) | ||
| IGc2 | 160..>214 | CDD:197706 | 13/53 (25%) | ||
| Ig | 262..328 | CDD:299845 | 6/27 (22%) | ||
| IG_like | 264..323 | CDD:214653 | 6/25 (24%) | ||
| IGc2 | 360..425 | CDD:197706 | |||
| Ig_3 | 456..519 | CDD:290638 | |||
| FN3 | 538..620 | CDD:238020 | |||
| FAM176 | 643..741 | CDD:291517 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||