| Sequence 1: | NP_001369656.1 | Gene: | F11R / 50848 | HGNCID: | 14685 | Length: | 327 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611765.2 | Gene: | side-V / 37679 | FlyBaseID: | FBgn0085400 | Length: | 1174 | Species: | Drosophila melanogaster |
| Alignment Length: | 269 | Identity: | 63/269 - (23%) |
|---|---|---|---|
| Similarity: | 97/269 - (36%) | Gaps: | 77/269 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Human 17 LAILLCSLALGSVTVHSSE-------PEVRIPENNPVKLSCAYS-GFSSPRVEWKFDQGDTTRLV 73
Human 74 CYNNKITASYEDRVTFLPTG-----ITFKSVTREDTGT-YTCMVSEEGGNSYGEV------KVKL 126
Human 127 IVLVPPSKPTVNIPSSATI-GNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVL 190
Human 191 NPTTGELVFDPLSASDTGEYSC-----------EARNGYGTPMTS----------------NAVR 228
Human 229 MEAVERNVG 237 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| F11R | NP_001369656.1 | IgV_1_JAM1-like | 30..129 | CDD:409538 | 30/118 (25%) |
| FR1 | 30..52 | CDD:409538 | 6/28 (21%) | ||
| Ig strand A | 30..33 | CDD:409538 | 0/2 (0%) | ||
| Ig strand A' | 37..41 | CDD:409538 | 0/3 (0%) | ||
| Ig strand B | 44..53 | CDD:409538 | 2/8 (25%) | ||
| CDR1 | 53..58 | CDD:409538 | 2/5 (40%) | ||
| Ig strand C | 58..66 | CDD:409538 | 4/7 (57%) | ||
| FR2 | 59..66 | CDD:409538 | 3/6 (50%) | ||
| CDR2 | 69..83 | CDD:409538 | 1/13 (8%) | ||
| Ig strand C' | 69..74 | CDD:409538 | 0/4 (0%) | ||
| Ig strand C' | 77..79 | CDD:409538 | 0/1 (0%) | ||
| FR3 | 84..112 | CDD:409538 | 11/33 (33%) | ||
| Ig strand D | 86..90 | CDD:409538 | 0/3 (0%) | ||
| Ig strand E | 92..96 | CDD:409538 | 1/8 (13%) | ||
| Ig strand F | 105..113 | CDD:409538 | 4/8 (50%) | ||
| CDR3 | 113..119 | CDD:409538 | 0/5 (0%) | ||
| Ig strand G | 119..128 | CDD:409538 | 5/14 (36%) | ||
| FR4 | 120..129 | CDD:409538 | 5/14 (36%) | ||
| IgI_2_JAM1 | 135..231 | CDD:409542 | 25/123 (20%) | ||
| Ig strand A | 135..139 | CDD:409542 | 0/3 (0%) | ||
| Ig strand A' | 141..144 | CDD:409542 | 0/2 (0%) | ||
| Ig strand B | 147..155 | CDD:409542 | 3/7 (43%) | ||
| Ig strand C | 163..168 | CDD:409542 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409542 | 1/1 (100%) | ||
| Ig strand D | 187..191 | CDD:409542 | 0/3 (0%) | ||
| Ig strand E | 195..199 | CDD:409542 | 2/3 (67%) | ||
| Ig strand F | 208..214 | CDD:409542 | 1/16 (6%) | ||
| Ig strand G | 221..231 | CDD:409542 | 3/25 (12%) | ||
| side-V | NP_611765.2 | V-set | 42..153 | CDD:462230 | 0/2 (0%) |
| Ig_3 | 178..243 | CDD:464046 | 21/81 (26%) | ||
| Ig | 274..359 | CDD:472250 | 21/90 (23%) | ||
| Ig strand B | 280..284 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 294..298 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 320..324 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 334..345 | CDD:409353 | 1/10 (10%) | ||
| Ig strand G | 355..358 | CDD:409353 | 1/2 (50%) | ||
| Ig | 400..466 | CDD:472250 | |||
| Ig strand B | 403..407 | CDD:409353 | |||
| Ig strand C | 416..421 | CDD:409353 | |||
| Ig strand E | 438..442 | CDD:409353 | |||
| Ig strand F | 452..457 | CDD:409353 | |||
| Ig strand G | 465..468 | CDD:409353 | |||
| FN3 | 719..798 | CDD:214495 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||