DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F11R and side-V

DIOPT Version :10

Sequence 1:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens
Sequence 2:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster


Alignment Length:269 Identity:63/269 - (23%)
Similarity:97/269 - (36%) Gaps:77/269 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    17 LAILLCSLALGSVTVHSSE-------PEVRIPENNPVKLSCAYS-GFSSPRVEWKFDQGDTTRLV 73
            :.:|:...||..:..|.:|       |.:   |.:.:.|:|..| |...|||.|..:.       
  Fly   150 VTVLVPPTALTILDHHGAEIRDQTAGPYL---EGDSIDLTCLSSGGVPPPRVSWWREH------- 204

Human    74 CYNNKITASYEDRVTFLPTG-----ITFKSVTREDTGT-YTCMVSEEGGNSYGEV------KVKL 126
                   |..:|....||.|     :..|::.|:|..| |||..|.      |.|      ||.|
  Fly   205 -------ALIDDSFQVLPDGSVRNVLRLKNIQRKDLLTMYTCQASN------GHVVPALTKKVIL 256

Human   127 IVLVPPSKPTVNIPSSATI-GNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVL 190
            .:.:||....:...:.|.| |.|:.:||:.....||.|..|.|.|.::.....||.:..|:    
  Fly   257 DMNLPPLSLLLQGLNHAVIAGTRSHVTCTAIGARPPPEIIWSKAGQIVRGATSSTSSDGNT---- 317

Human   191 NPTTGELVFDPLSASDTGEYSC-----------EARNGYGTPMTS----------------NAVR 228
              |..||:..|:...:..:..|           :...|:.|.||:                |...
  Fly   318 --TISELMLIPVPEDNERQVVCSISLNAGITSQQLHEGHTTVMTTLGNGHTGLYLKDSRVLNVTH 380

Human   229 MEAVERNVG 237
            ...|..|:|
  Fly   381 APIVNLNLG 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 30/118 (25%)
FR1 30..52 CDD:409538 6/28 (21%)
Ig strand A 30..33 CDD:409538 0/2 (0%)
Ig strand A' 37..41 CDD:409538 0/3 (0%)
Ig strand B 44..53 CDD:409538 2/8 (25%)
CDR1 53..58 CDD:409538 2/5 (40%)
Ig strand C 58..66 CDD:409538 4/7 (57%)
FR2 59..66 CDD:409538 3/6 (50%)
CDR2 69..83 CDD:409538 1/13 (8%)
Ig strand C' 69..74 CDD:409538 0/4 (0%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 11/33 (33%)
Ig strand D 86..90 CDD:409538 0/3 (0%)
Ig strand E 92..96 CDD:409538 1/8 (13%)
Ig strand F 105..113 CDD:409538 4/8 (50%)
CDR3 113..119 CDD:409538 0/5 (0%)
Ig strand G 119..128 CDD:409538 5/14 (36%)
FR4 120..129 CDD:409538 5/14 (36%)
IgI_2_JAM1 135..231 CDD:409542 25/123 (20%)
Ig strand A 135..139 CDD:409542 0/3 (0%)
Ig strand A' 141..144 CDD:409542 0/2 (0%)
Ig strand B 147..155 CDD:409542 3/7 (43%)
Ig strand C 163..168 CDD:409542 2/4 (50%)
Ig strand C' 170..172 CDD:409542 1/1 (100%)
Ig strand D 187..191 CDD:409542 0/3 (0%)
Ig strand E 195..199 CDD:409542 2/3 (67%)
Ig strand F 208..214 CDD:409542 1/16 (6%)
Ig strand G 221..231 CDD:409542 3/25 (12%)
side-VNP_611765.2 V-set 42..153 CDD:462230 0/2 (0%)
Ig_3 178..243 CDD:464046 21/81 (26%)
Ig 274..359 CDD:472250 21/90 (23%)
Ig strand B 280..284 CDD:409353 0/3 (0%)
Ig strand C 294..298 CDD:409353 1/3 (33%)
Ig strand E 320..324 CDD:409353 2/3 (67%)
Ig strand F 334..345 CDD:409353 1/10 (10%)
Ig strand G 355..358 CDD:409353 1/2 (50%)
Ig 400..466 CDD:472250
Ig strand B 403..407 CDD:409353
Ig strand C 416..421 CDD:409353
Ig strand E 438..442 CDD:409353
Ig strand F 452..457 CDD:409353
Ig strand G 465..468 CDD:409353
FN3 719..798 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.