DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F11R and lbk

DIOPT Version :9

Sequence 1:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens
Sequence 2:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster


Alignment Length:261 Identity:65/261 - (24%)
Similarity:104/261 - (39%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    28 SVTVHSSEPEVRIPEN------NPVKLSCAYSGFSSPRVE-WKFDQGDTTRLVCYNNKITASYED 85
            |:.:|.:  .:::|.|      ...:|.|:.||..:|.:. .||.          .::..|:.|.
  Fly   829 SIGIHPT--FLQVPSNLTLDAGEMARLVCSASGDPTPEIALQKFG----------GSEFPAATER 881

Human    86 RV-------TFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP--- 140
            |:       .||.|     :....|:|.|||...    ::.||:||. ..||...||..:||   
  Fly   882 RLQVIREENAFLIT-----NAKPSDSGIYTCTAL----SAAGEIKVN-ATLVVNDKPQPSIPLVH 936

Human   141 SSATIGNRAVLTCSEQDGSPPSEY-----TWFKDG---IVMPTNPKSTR-AFSNSSYVLNPTTGE 196
            ....:|...||.|..:..:...|.     .|||:.   .:.||.|...| .|||:..:       
  Fly   937 QEVVVGRTCVLQCLSETANADFELEHPHREWFKENKPIHISPTAPDGDRYYFSNNKEL------- 994

Human   197 LVFDPLSASDTGEYSCEARNGYGT-PMTSNAVRMEAVERN---VGVIVAAVLVTLILLGILVFGI 257
            ||.....::|.|.:.||..:...| .:.|..|   .|:.|   |.::|..:.||:|.:.:....|
  Fly   995 LVILNAQSNDAGHFRCEITDNSRTFTLQSELV---VVKENLNWVVLLVGIITVTVICVVVDCCII 1056

Human   258 W 258
            |
  Fly  1057 W 1057

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 25/112 (22%)
Ig strand B 46..50 CDD:409538 1/3 (33%)
Ig strand C 59..63 CDD:409538 0/4 (0%)
Ig strand E 92..96 CDD:409538 1/3 (33%)
Ig strand F 106..111 CDD:409538 3/4 (75%)
Ig strand G 121..124 CDD:409538 1/2 (50%)
IgI_2_JAM1 135..231 CDD:409542 27/108 (25%)
Ig strand B 149..153 CDD:409542 2/3 (67%)
Ig strand C 163..167 CDD:409542 1/8 (13%)
Ig strand E 195..199 CDD:409542 1/3 (33%)
Ig strand F 209..214 CDD:409542 1/4 (25%)
Ig strand G 224..227 CDD:409542 1/2 (50%)
lbkNP_611091.2 LRR_RI <275..446 CDD:238064
leucine-rich repeat 293..316 CDD:275380
LRR_8 316..373 CDD:290566
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380
leucine-rich repeat 363..386 CDD:275380
LRR_8 386..445 CDD:290566
leucine-rich repeat 387..410 CDD:275380
leucine-rich repeat 411..434 CDD:275380
leucine-rich repeat 435..457 CDD:275380
LRR_8 457..516 CDD:290566
leucine-rich repeat 458..481 CDD:275380
leucine-rich repeat 482..505 CDD:275380
LRR_RI <498..669 CDD:238064
LRR_8 504..564 CDD:290566
leucine-rich repeat 506..529 CDD:275380
leucine-rich repeat 530..553 CDD:275380
leucine-rich repeat 554..577 CDD:275380
LRR_8 576..641 CDD:290566
leucine-rich repeat 578..604 CDD:275380
leucine-rich repeat 607..630 CDD:275380
leucine-rich repeat 631..652 CDD:275380
LRRCT 665..712 CDD:214507
IG 734..823 CDD:214652
Ig 735..823 CDD:143165
I-set 834..924 CDD:254352 25/111 (23%)
Ig 851..924 CDD:299845 23/92 (25%)
IG 936..1027 CDD:214652 24/100 (24%)
Ig 961..1020 CDD:143165 17/65 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.