Sequence 1: | NP_001369656.1 | Gene: | F11R / 50848 | HGNCID: | 14685 | Length: | 327 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245505.1 | Gene: | kirre / 31292 | FlyBaseID: | FBgn0028369 | Length: | 956 | Species: | Drosophila melanogaster |
Alignment Length: | 307 | Identity: | 71/307 - (23%) |
---|---|---|---|
Similarity: | 103/307 - (33%) | Gaps: | 89/307 - (28%) |
- Green bases have known domain annotations that are detailed below.
Human 10 KLLCLFILAILLCSLALGSVTVH-------SSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQ- 66
Human 67 ----GDT--TRLVCYNNKITASYEDRVTFLPTGITFK----SVTREDTG-----------TYTCM 110
Human 111 VSEEGGN-----------------------SYGEVKV-----KLIVLVPPSKPTVNIPSSATIGN 147
Human 148 RAVLT--------CSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGE-------- 196
Human 197 LVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIVAAV 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
F11R | NP_001369656.1 | IgV_1_JAM1-like | 30..129 | CDD:409538 | 31/155 (20%) |
Ig strand B | 46..50 | CDD:409538 | 0/3 (0%) | ||
Ig strand C | 59..63 | CDD:409538 | 0/3 (0%) | ||
Ig strand E | 92..96 | CDD:409538 | 0/3 (0%) | ||
Ig strand F | 106..111 | CDD:409538 | 1/4 (25%) | ||
Ig strand G | 121..124 | CDD:409538 | 1/2 (50%) | ||
IgI_2_JAM1 | 135..231 | CDD:409542 | 23/111 (21%) | ||
Ig strand B | 149..153 | CDD:409542 | 2/11 (18%) | ||
Ig strand C | 163..167 | CDD:409542 | 2/3 (67%) | ||
Ig strand E | 195..199 | CDD:409542 | 1/11 (9%) | ||
Ig strand F | 209..214 | CDD:409542 | 1/4 (25%) | ||
Ig strand G | 224..227 | CDD:409542 | 1/2 (50%) | ||
kirre | NP_001245505.1 | Ig | 87..183 | CDD:299845 | 19/96 (20%) |
IG_like | 88..182 | CDD:214653 | 19/94 (20%) | ||
C2-set_2 | 189..279 | CDD:285423 | 22/103 (21%) | ||
Ig_2 | 307..379 | CDD:290606 | |||
I-set | 382..462 | CDD:254352 | |||
IGc2 | 396..446 | CDD:197706 | |||
Ig | 466..561 | CDD:299845 | |||
IG_like | 478..561 | CDD:214653 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |