DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F11R and kirre

DIOPT Version :9

Sequence 1:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:307 Identity:71/307 - (23%)
Similarity:103/307 - (33%) Gaps:89/307 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    10 KLLCLFILAILLCSLALGSVTVH-------SSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQ- 66
            :||.|.::.:|:.:|.|..:.||       ||:.......::....|.:.||.||.......|: 
  Fly     8 RLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSSSAAASSANDES 72

Human    67 ----GDT--TRLVCYNNKITASYEDRVTFLPTGITFK----SVTREDTG-----------TYTCM 110
                ||.  ..........||....||| ||..:..|    ..|::|.|           .|:.:
  Fly    73 KPKGGDNGGQHFAMEPQDQTAVVGSRVT-LPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMV 136

Human   111 VSEEGGN-----------------------SYGEVKV-----KLIVLVPPSKPTVNIPSSATIGN 147
            .|:|.|:                       ..||..:     ||.|||||..|.:      |.|:
  Fly   137 GSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI------TQGD 195

Human   148 RAVLT--------CSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGE-------- 196
            ..|.|        |..|.|.|.:|.||. ||:       .........||..|....        
  Fly   196 YLVTTEDREIELECVSQGGKPAAEITWI-DGL-------GNVLTKGIEYVKEPLADSRRITARSI 252

Human   197 LVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIVAAV 243
            |...|........::|:|:|.......|..:.:| |:....|||:.|
  Fly   253 LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLE-VKYAPKVIVSVV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 31/155 (20%)
Ig strand B 46..50 CDD:409538 0/3 (0%)
Ig strand C 59..63 CDD:409538 0/3 (0%)
Ig strand E 92..96 CDD:409538 0/3 (0%)
Ig strand F 106..111 CDD:409538 1/4 (25%)
Ig strand G 121..124 CDD:409538 1/2 (50%)
IgI_2_JAM1 135..231 CDD:409542 23/111 (21%)
Ig strand B 149..153 CDD:409542 2/11 (18%)
Ig strand C 163..167 CDD:409542 2/3 (67%)
Ig strand E 195..199 CDD:409542 1/11 (9%)
Ig strand F 209..214 CDD:409542 1/4 (25%)
Ig strand G 224..227 CDD:409542 1/2 (50%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 19/96 (20%)
IG_like 88..182 CDD:214653 19/94 (20%)
C2-set_2 189..279 CDD:285423 22/103 (21%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.