DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F11R and F11r

DIOPT Version :10

Sequence 1:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens
Sequence 2:NP_766235.1 Gene:F11r / 16456 MGIID:1321398 Length:300 Species:Mus musculus


Alignment Length:329 Identity:205/329 - (62%)
Similarity:250/329 - (75%) Gaps:31/329 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFD 65
            |||:.:..||||.|| .:::|.||..|..:|::::.:|::|||..:||:|.|||||||||||||.
Mouse     1 MGTEGKAGRKLLFLF-TSMILGSLVQGKGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFV 64

Human    66 QGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLV 130
            ||.||.|||||::|||.|.|||||..:||||.||||:|.|.||||||||||.:||||.:.|.|||
Mouse    65 QGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLV 129

Human   131 PPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPT-NPKSTRAFSNSSYVLNPTT 194
            ||||||:::|||.||||||||||||.||||||||:||||||.|.| :.|.||||.|||:.::|.:
Mouse   130 PPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKS 194

Human   195 GELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWF 259
            |:|:|||::|.|:|||.|:|:|||||.|.|.|..|:|||.|||.|||||||||||||:|:||:||
Mouse   195 GDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWF 259

Human   260 AYSRGHFDKLGACPSIFPSHAVFCPADTHDPISSLSGTKKGTS-SKKVIYSQPSARSEGEFKQTS 323
            |||||:|::                            |||||: .|||||||||.||||||||||
Mouse   260 AYSRGYFER----------------------------TKKGTAPGKKVIYSQPSTRSEGEFKQTS 296

Human   324 SFLV 327
            ||||
Mouse   297 SFLV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 64/98 (65%)
FR1 30..52 CDD:409538 8/21 (38%)
Ig strand A 30..33 CDD:409538 1/2 (50%)
Ig strand A' 37..41 CDD:409538 1/3 (33%)
Ig strand B 44..53 CDD:409538 3/8 (38%)
CDR1 53..58 CDD:409538 4/4 (100%)
Ig strand C 58..66 CDD:409538 7/7 (100%)
FR2 59..66 CDD:409538 6/6 (100%)
CDR2 69..83 CDD:409538 10/13 (77%)
Ig strand C' 69..74 CDD:409538 3/4 (75%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 19/27 (70%)
Ig strand D 86..90 CDD:409538 3/3 (100%)
Ig strand E 92..96 CDD:409538 2/3 (67%)
Ig strand F 105..113 CDD:409538 6/7 (86%)
CDR3 113..119 CDD:409538 4/5 (80%)
Ig strand G 119..128 CDD:409538 5/8 (63%)
FR4 120..129 CDD:409538 4/8 (50%)
IgI_2_JAM1 135..231 CDD:409542 63/96 (66%)
Ig strand A 135..139 CDD:409542 2/3 (67%)
Ig strand A' 141..144 CDD:409542 2/2 (100%)
Ig strand B 147..155 CDD:409542 7/7 (100%)
Ig strand C 163..168 CDD:409542 3/4 (75%)
Ig strand C' 170..172 CDD:409542 1/1 (100%)
Ig strand D 187..191 CDD:409542 1/3 (33%)
Ig strand E 195..199 CDD:409542 2/3 (67%)
Ig strand F 208..214 CDD:409542 4/5 (80%)
Ig strand G 221..231 CDD:409542 4/9 (44%)
F11rNP_766235.1 Ig 29..128 CDD:472250 64/98 (65%)
Ig strand B 45..49 CDD:409538 2/3 (67%)
Ig strand C 58..62 CDD:409538 3/3 (100%)
Ig strand E 91..95 CDD:409538 2/3 (67%)
Ig strand F 105..110 CDD:409538 3/4 (75%)
Ig strand G 120..123 CDD:409538 2/2 (100%)
Ig 134..231 CDD:472250 63/96 (66%)
Ig strand B 148..152 CDD:409353 3/3 (100%)
Ig strand C 162..166 CDD:409353 2/3 (67%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 3/4 (75%)
Ig strand G 224..227 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.