DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX9 and hbn

DIOPT Version :10

Sequence 1:NP_006185.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:231 Identity:54/231 - (23%)
Similarity:75/231 - (32%) Gaps:67/231 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   128 RNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPP-GVPAIPGSVAMPRT 191
            |.|..|..:.|:.        .|:..||     .:|       ..:|.|| |:|..|||: ....
  Fly   211 REKFMNQDKAGYL--------LPEQGLP-----EFP-------LGIPLPPHGLPGHPGSM-QSEF 254

Human   192 WP-----SSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSS--LGRNNFPAAAPHAVNGLEKGAL 249
            ||     ..|..........:..|...:..|..|......|  :|.:|.     :.:.|....|.
  Fly   255 WPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNL-----NGIFGAGAAAA 314

Human   250 EQEAKYGQAPN-----GLPAVGSFVS----------ASSMAPYPTPAQVSPYMTYSAAPSGYVAG 299
            ...|..|...|     ||.|: |.||          :..:.|:|||...:|       |:|...|
  Fly   315 AAAASAGYPQNLSLHAGLSAM-SQVSPPCSNSSPRESPKLVPHPTPPHATP-------PAGGNGG 371

Human   300 HGWQHAGGTSL---SPH-------NCDIPASLAFKG 325
            .|....|..|.   ||:       |...|.|:..||
  Fly   372 GGLLTGGLISTAAQSPNSAAGASSNASTPVSVVTKG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX9NP_006185.1 PAX 6..131 CDD:238076 1/2 (50%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 1/1 (100%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 8/21 (38%)
hbnNP_788420.1 Homeodomain 154..210 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.