DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX9 and Poxm

DIOPT Version :9

Sequence 1:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:402 Identity:169/402 - (42%)
Similarity:196/402 - (48%) Gaps:133/402 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     3 PAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSIL 67
            |.:|||||||||||||||||||.|:||||||:||||||||||||||||||||||||||:||||||
  Fly     8 PQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSIL 72

Human    68 PGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIG 132
            ||||||||||||||.||.:||..|||||||||||||||||::|:|||.|||||||||||||||:|
  Fly    73 PGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLG 137

Human   133 NLAQQ---------------------------------------------GHYDSYKQHQPTPQP 152
            :|..|                                             .|:..:..|..:...
  Fly   138 SLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAAA 202

Human   153 ALPYNHIYSYP-----------SPITAAAA-KVPTPPGVPAIP------GSVAMPRT-------- 191
            |...:|::::.           .|.:|||| .:.||.|.|:.|      |||..|..        
  Fly   203 AASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPHQLRSVAAAA 267

Human   192 ----WPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQE 252
                |||||||:|||.              |...|                         ||...
  Fly   268 AAAHWPSSHSVSDILA--------------HHQAV-------------------------ALRAS 293

Human   253 AKYGQAPNGLPAVGSFVSASSMAPYPT---------------PAQVSPYMTYSAAPSGYVAGH-- 300
            .:.|....|:..:||.||...|.|.|.               ..|.|||..|....:|.:..|  
  Fly   294 CQVGVGVGGMGGMGSTVSPLPMTPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQNGGMHHHHH 358

Human   301 --GWQHAGGTSL 310
              |...||.|.|
  Fly   359 HGGMMAAGATGL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX9NP_001359005.1 PAX 6..131 CDD:238076 111/124 (90%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63 51/55 (93%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 38/47 (81%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 12/27 (44%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 108/122 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2542
eggNOG 1 0.900 - - E1_KOG3517
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 247 1.000 Inparanoid score I3265
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1339212at2759
OrthoFinder 1 1.000 - - FOG0003351
OrthoInspector 1 1.000 - - otm40766
orthoMCL 1 0.900 - - OOG6_106145
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3849
SonicParanoid 1 1.000 - - X2237
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.