DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX9 and gsb-n

DIOPT Version :9

Sequence 1:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:342 Identity:120/342 - (35%)
Similarity:168/342 - (49%) Gaps:57/342 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEPAF--------GEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKIL 57
            :.|.|        |.||||||||:|||||||.|||:|||:|..|:|||.||||||||||||||||
  Fly     9 LRPLFAGYPFQGQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKIL 73

Human    58 ARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSS 122
            .||.|||||.||.||||||:||:|.:...|...::.:|.||:||||::|:.:|..|.   ||.||
  Fly    74 NRYQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFADP---PSTSS 135

Human   123 ISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIY-SYPSPITAAAAKVPTPPGVPAIPGSV 186
            |||:||.     :.:|..|..|.:        ..|.|. ...|.|:...::    ||:| :....
  Fly   136 ISRLLRG-----SDRGSEDGRKDY--------TINGILGGRDSDISDTESE----PGIP-LKRKQ 182

Human   187 AMPRTWPSSHSVTDILGIRSIT--------DQVSDSSPYHSPKVEEWSSLGRNNF---------- 233
            ...||..::..:..:....|.|        ::::.::.....:::.|.|..|...          
  Fly   183 RRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSG 247

Human   234 --PAAAPHAVNGLEKGALEQEAKYGQAPNGL-------PAVGSFVSASSMAPYPTPAQVSPYMTY 289
              |..:..:..|:..|.....|..|..|.|:       ||.|:..:.:.|......|..:|...:
  Fly   248 LSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATGAGMNDGVHHAAHAPSSHH 312

Human   290 SAAPSGYVAGHGWQHAG 306
            |||.:...|.|..|..|
  Fly   313 SAATAAAAAHHHTQMGG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX9NP_001359005.1 PAX 6..131 CDD:238076 81/124 (65%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63 44/55 (80%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 20/47 (43%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 3/20 (15%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 79/123 (64%)
Homeobox 185..238 CDD:278475 7/52 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.