DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX9 and al

DIOPT Version :9

Sequence 1:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:254 Identity:59/254 - (23%)
Similarity:85/254 - (33%) Gaps:87/254 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    67 LPG-------AIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSIS 124
            |||       .:|.:.|    |....|: .::.|.|  |..:....|.|      :..|.:|:..
  Fly   157 LPGGAATMQTVVGAALP----PNPFTHL-GFQLRKP--FDAQHAANLAA------FRYPHLSAAP 208

Human   125 RILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSY-PS----PITAAAAKVP--TPPGVP-- 180
            .|         ..|:::   |.|..|...||:.....| ||    .:.|....||  ||.|.|  
  Fly   209 MI---------PSGYFN---QFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPA 261

Human   181 AIPGS---------VAMPRTWPSS-HSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPA 235
            .:.||         :|.|.|.|:| |:           .|.......|.|.            |.
  Fly   262 LLVGSPDLHSPNHMLASPPTSPASGHA-----------SQHQQHPTAHPPP------------PQ 303

Human   236 AAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPY-MTYSAAP 293
            |.|....|::...|        :|..|..:.....|||:    :|.|.||. :|.|.:|
  Fly   304 APPQMPVGVQPAQL--------SPQHLVGIALTQQASSL----SPTQTSPVALTLSHSP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX9NP_001359005.1 PAX 6..131 CDD:238076 15/70 (21%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 9/47 (19%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 10/33 (30%)
alNP_722629.1 Homeobox 89..141 CDD:278475
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.