DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX7 and pax7

DIOPT Version :10

Sequence 1:NP_002575.1 Gene:PAX7 / 5081 HGNCID:8621 Length:520 Species:Homo sapiens
Sequence 2:XP_031761992.1 Gene:pax7 / 100496502 XenbaseID:XB-GENE-487140 Length:504 Species:Xenopus tropicalis


Alignment Length:109 Identity:32/109 - (29%)
Similarity:38/109 - (34%) Gaps:30/109 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    65 SLLKA-AAASGGSRAPRHSSARDPGLRG--RRLPG-----PCPG--------------SPPPCGD 107
            :||.| .||.|.:.|||...|::.. ||  ..|||     .|||              .|.....
 Frog     7 ALLAALLAAPGAALAPRRCPAQEVA-RGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH 70

Human   108 PS-----SRRPLCRPVPRDEGARGS--RRGLPQAHCRPRETLPP 144
            ||     .||.|.|.|...:....|  |.|.|.........:||
 Frog    71 PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX7NP_002575.1 paired box domain 34..164 32/109 (29%)
PAX 34..163 CDD:238076 32/109 (29%)
octapeptide 86..93 2/8 (25%)
paired homeodomain 217..275
Homeodomain 218..274 CDD:459649
Pax7 347..385 CDD:403540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409
pax7XP_031761992.1 PAX 35..162 CDD:128645 20/80 (25%)
Homeodomain 219..275 CDD:459649
Pax7 345..384 CDD:403540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.