DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AK3 and CG9541

DIOPT Version :10

Sequence 1:NP_057366.2 Gene:AK3 / 50808 HGNCID:17376 Length:227 Species:Homo sapiens
Sequence 2:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster


Alignment Length:197 Identity:43/197 - (21%)
Similarity:73/197 - (37%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    12 IMGAPGSGKGTVSSR-ITTHFELKHLSSGDLLR---DNMLRGTEIGVLAKAFIDQGKLIPDDVMT 72
            ::|.|||.|.|:..: :..:....|:|.|.|||   |:..|........|..:..|.:.|:..:.
  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLN 426

Human    73 RLALHELKNLTQYSWLL-DGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQR-----LTARWIH 131
            :|....|:.|...:.:: ||:||.|.|.:..:..|               |||     |....:.
  Fly   427 QLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKY---------------KQRPPIILLDCSKLQ 476

Human   132 PASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETF 196
            ...||:                         ||...:..:||:.:.:||.|:|:.......|:..
  Fly   477 LGRGRI-------------------------DDTVSSFRRRLELFREQTLPMLKILDTSNRLQIV 516

Human   197 SG 198
            .|
  Fly   517 DG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AK3NP_057366.2 ADK 12..190 CDD:395329 41/187 (22%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.11 37..66 9/31 (29%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.11 127..164 2/36 (6%)
CG9541NP_001260273.1 ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/197 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.