DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNK4 and Sh

DIOPT Version :10

Sequence 1:NP_201567.1 Gene:KCNK4 / 50801 HGNCID:6279 Length:393 Species:Homo sapiens
Sequence 2:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster


Alignment Length:98 Identity:31/98 - (31%)
Similarity:42/98 - (42%) Gaps:25/98 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   166 LVRVLSA--------MLFLLIGCLLFVLTPTFVFCYMED---WSKLEAIYFVIVTLTTVGFGDYV 219
            |.|.|.|        :.||.||.:||.....|.....|:   .|..:|.::.:||:||||:||..
  Fly   385 LGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMT 449

Human   220 AGADPRQDSPAYQPL-VWFWILLGLAYFASVLT 251
                         |: ||..|:..|...|.|||
  Fly   450 -------------PVGVWGKIVGSLCAIAGVLT 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNK4NP_201567.1 Ion_trans_2 <88..142 CDD:462301
Selectivity filter 1. /evidence=ECO:0000269|PubMed:22282805, ECO:0000269|PubMed:23341632, ECO:0000269|PubMed:25471887, ECO:0000269|PubMed:25500157 103..108
Ion_trans_2 180..258 CDD:462301 23/76 (30%)
Selectivity filter 2. /evidence=ECO:0000269|PubMed:22282805, ECO:0000269|PubMed:23341632, ECO:0000269|PubMed:25471887, ECO:0000269|PubMed:25500157 212..217 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..393
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 31/98 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.