DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX6 and Poxm

DIOPT Version :9

Sequence 1:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:412 Identity:142/412 - (34%)
Similarity:182/412 - (44%) Gaps:110/412 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    89 VNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIG 153
            |||||||||||||||::||.:|||||..|.|||||||.|:||:|||||||.||:|||||.|.|||
  Fly    13 VNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGAIG 77

Human   154 GSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQM 218
            ||||||.||:||:.|.:.|:..|.||||||||||||||:|...|:||||||:|:|||        
  Fly    78 GSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRN-------- 134

Human   219 GADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQM 283
                   ||    |..|...|     |||.:       |.....|||    |:||||.       
  Fly   135 -------KL----GSLGHQHT-----PGTVM-------GSGSSSGGG----SVSSNGG------- 165

Human   284 RLQLKRKLQRNRTSFTQE-QIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWR 347
                    |.|.||.:.. .:..|.......|:|......:.||                     
  Fly   166 --------QNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAA--------------------- 201

Human   348 REEKLRNQRRQASNTPSHIPISSSFSTSVYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPP 412
                       |:.:..|:...:.....:|..|.||.:..::::..:..|          |..||
  Fly   202 -----------AAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCG----------SPSPP 245

Human   413 MPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHM--------QTHMNSQPMGT 469
            ..:....:     .|.|.|..|.:.....:...:..|.......|.        |..:....||.
  Fly   246 QGAGGQGS-----VPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVGVGGMGG 305

Human   470 SGTTSTGLISPGVSVPVQVPGS 491
            .|:|    :||....|..|.|:
  Fly   306 MGST----VSPLPMTPSPVAGT 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX6NP_001355839.1 PAX 85..209 CDD:128645 87/119 (73%)
Homeobox 295..348 CDD:395001 7/53 (13%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 87/119 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.