DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX6 and Zasp66

DIOPT Version :9

Sequence 1:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:459 Identity:89/459 - (19%)
Similarity:152/459 - (33%) Gaps:148/459 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    73 PSP---GSDSHVCTGGHSGVNQLGGVFV----NGRPLPDSTRQKIVE-----LAHSGARPC---- 121
            |||   .|.|.:....|....|..||.|    :|..|......||.|     |:|:.|:..    
  Fly    43 PSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGA 107

Human   122 --DISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIR 184
              :|..::...|. ::...|...|.|.       ||:.....|.|...:..::...|.:......
  Fly   108 GNEIRLVVHRDNK-IAYTQGATQEAGP-------GSRSNSTLPPVTPDLMPHRGPSPFLPGPSHF 164

Human   185 DRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSV 249
            :|.|...|   |.:|.            :...|:.:.|.|:                  .|.|..
  Fly   165 ERALQLPV---DTLPQ------------TVFPQLNSSGGYE------------------VPSTVF 196

Human   250 PGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTS-----FTQEQIEALEKE 309
            ..:||:|                 :.:|.||.|..:    ..|..||:     ..:.:.:|...|
  Fly   197 SPKPTRD-----------------HQQDVDEEQAAI----VNQPYRTTPLVLPGAKVKKDAPTTE 240

Human   310 FERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFST 374
            ....|||:             |..|......       ..:.:..||  .::|..|..:.|...|
  Fly   241 SYLRHYPN-------------PAVRAHPGHD-------YHDSIMKQR--VADTMLHKVVGSEADT 283

Human   375 S-VYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANN----LPMQPPVPSQTSS 434
            . |:.  .|..:|:..:::.::    :..:.:|      :|..|..:|    .|:..|:|::.:.
  Fly   284 GRVFH--KQFNSPIGLYSNNNI----EDTIRST------VPFATSESNRLKDSPLHRPLPTKLNG 336

Human   435 YSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISP-GVSVPVQ---------VP 489
            |            :....|.|.:.:|:...|..|  |.::.|..|| .|::|||         ||
  Fly   337 Y------------KKTVQYDPRNSETYRAIQEEG--GYSNYGQSSPQEVTIPVQTKVYQPNRLVP 387

Human   490 GSEP 493
            |.:|
  Fly   388 GKKP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX6NP_001355839.1 PAX 85..209 CDD:128645 28/138 (20%)
Homeobox 295..348 CDD:395001 9/57 (16%)
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 11/46 (24%)
DUF4749 285..359 CDD:292558 16/99 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.