DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX6 and Awh

DIOPT Version :9

Sequence 1:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:184 Identity:54/184 - (29%)
Similarity:78/184 - (42%) Gaps:47/184 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   262 EGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAA 326
            |||   |.| |..|.|.|...     |.|.:|.||:||:||::.|:..|:....||....||:|:
  Fly   128 EGG---TTS-SDEGCDGDGYH-----KSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIAS 183

Human   327 KIDLPEARIQVWFSNRRAKWRR-----EEKLRNQRRQASNTPSHI--PISSSFSTSVYQPIPQPT 384
            ...|.:...||||.|.||:.::     :.|:|..  :.|:...||  .::.||..:...|:    
  Fly   184 VTGLSKRVTQVWFQNSRARQKKHIHAGKNKIREP--EGSSFARHINLQLTYSFQNNAQNPM---- 242

Human   385 TPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCM 438
                 ..:||..|            |.|....:| :.|       ||.||..||
  Fly   243 -----HLNGSKAG------------LYPTHESSM-DEL-------SQDSSVHCM 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX6NP_001355839.1 PAX 85..209 CDD:128645
Homeobox 295..348 CDD:395001 21/52 (40%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.