DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX6 and Zasp52

DIOPT Version :9

Sequence 1:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens
Sequence 2:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster


Alignment Length:627 Identity:121/627 - (19%)
Similarity:199/627 - (31%) Gaps:188/627 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    12 TSEISEPH-----IRAPWNPAAPSQSQHAEQGGRSSAAEIKRAVAGANRL------------PAL 59
            ||:.|..|     :.||....|||:.:..|:..:.|...|....:|...:            .||
  Fly  1443 TSDSSTVHRPIAQVAAPTTVVAPSREREKERRPQLSVPIIVEDRSGPVTMAFQPLDELVRPDQAL 1507

Human    60 SLTCGGRTCLWLKPSP------GSDSHV---CTGGHS-GVNQLGGVFVNGRPLPDSTRQKIVELA 114
            :.|......|..||:|      ..:..|   |:..|: ..|:|     |..|.||.||...    
  Fly  1508 TPTRPYTPSLTNKPAPIVPFYQTEEKLVFEECSATHARNYNEL-----NASPFPDRTRSPA---- 1563

Human   115 HSGARPCDI--------------SRILQVSNG----CVSKILGRYYETGSIRPRAIGGS------ 155
             .|..|..:              |.||.||.|    ..|...|:.|: |.:...:...|      
  Fly  1564 -PGPPPNPLNAIRAPRMKEPETKSNILSVSGGPRLQTGSITTGQSYQ-GQLLAHSEQSSQSASQS 1626

Human   156 ---KPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ 217
               :|...|.:.|..:...:||..|....:.:.:..|:   |...:.:.....|  |.:..|.::
  Fly  1627 YNQQPERITEQRVGNLNIQQREQSSQLQQQAQSQTQSQ---TRSQVGNTQIERR--RKVTEEFER 1686

Human   218 MGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQ 282
            .      ...:.:..:|||...........|:....||  .|.|.....:|...||.|:....|.
  Fly  1687 T------QSAKTIEIRTGSQSVSQSKAQSQSISQAQTQ--AQSQSQNQSDTERRSSYGKTGFVAS 1743

Human   283 MRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWR 347
                     |..|.|..:|:|.:|..:.:.     :.||.....:...|..|...:.|....|..
  Fly  1744 ---------QAKRLSCMEEEISSLTSQSQA-----ISARASALGEGCFPNLRSPTFDSKFPLKPA 1794

Human   348 REEKL------------------------RNQRRQASNTPSHIPISSSFSTSVYQPIPQPTTPVS 388
            ..|.:                        :.|::|.|....:...:||...|.:....:.||  |
  Fly  1795 PAESIVPGYATVPAATKMLTAPPPGFLQQQQQQQQRSAFSGYQATTSSVQQSSFASSSKATT--S 1857

Human   389 SFTSGSMLGRTDTALTNTYSALPPMPSFTMAN------------------NLPMQPPVPSQTSSY 435
            |.:|.|.......::..:..:|....:.|...                  ||..:|.:.|.|:..
  Fly  1858 SLSSSSASASASASVARSSQSLTQASAITTTTNNQATTAYRSSNGSITKPNLASRPSIASITAPG 1922

Human   436 SCMLP-----------TSP--------SVNGRSYDTYTPP------------HMQTHMNSQP--- 466
            |...|           |:|        ||...:.:...||            ::.:::::.|   
  Fly  1923 SASAPAPVPSAAPTKATAPFKAPIVPKSVIANAVNAAAPPAPAVFPPDLSDLNLNSNVDNSPGAG 1987

Human   467 ---MGTSGTTST-----GLIS----PGVSVP------VQVPG 490
               .|..|.||.     |:::    |||.:|      ||:.|
  Fly  1988 GKSAGAFGATSAPKRGRGILNKAAGPGVRIPLCNSCNVQIRG 2029

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX6NP_001355839.1 PAX 85..209 CDD:128645 31/151 (21%)
Homeobox 295..348 CDD:395001 11/52 (21%)
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 3/10 (30%)
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.