DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX6 and Gsc

DIOPT Version :9

Sequence 1:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:381 Identity:106/381 - (27%)
Similarity:149/381 - (39%) Gaps:88/381 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    13 SEISEPHIRAPWNPAAPSQSQHAEQGGRSSAAEIKRAVAGANRLPAL-----SLTCGGRTCLWLK 72
            |.:.:.|.:...:.:....|....|.|.:...|.:|..|.|..|..:     |...||.|     
  Fly   120 SVLQQQHAQHQQSQSQTPSSDDGSQSGVTILEEERRGGAAAASLFTIDSILGSRQQGGGT----- 179

Human    73 PSPGSDSHVCTGGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKI 137
             :|...||:.:.|    || .|:..||..|         .|..|||.    |.....||...|. 
  Fly   180 -APSQGSHISSNG----NQ-NGLTSNGISL---------GLKRSGAE----SPASPNSNSSSSA- 224

Human   138 LGRYYETGSIRPRAIGG--SKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPS 200
                 ....|||:.:..  ..|.:....:.:..|......||.|.           |...:..|:
  Fly   225 -----AASPIRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFL-----------VAYPNFYPN 273

Human   201 VSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYP-----GTSVPGQPTQDGCQQ 260
            ......| .::|:.:.|....|   ....|:|. |.....|..:|     |....||        
  Fly   274 YMHAAAV-AHVAAAQMQAHVSG---AAAGLSGH-GHHPHHPHGHPHHPHLGAHHHGQ-------- 325

Human   261 QEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLA 325
                    :.:|..|.....       ||| :|:||.||:||:|.||..|::||||||..||:||
  Fly   326 --------HHLSHLGHGPPP-------KRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLA 374

Human   326 AKIDLPEARIQVWFSNRRAKWRR-----EEKLRN-QRRQASNTPSHIPISSSFSTS 375
            .|:||.|.|::|||.|||||||:     :|:||. |..|..:|.:....|||.:||
  Fly   375 LKVDLKEERVEVWFKNRRAKWRKQKREEQERLRKLQEEQCGSTTNGTTNSSSGTTS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX6NP_001355839.1 PAX 85..209 CDD:128645 26/125 (21%)
Homeobox 295..348 CDD:395001 34/52 (65%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.