DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX5 and gsb-n

DIOPT Version :9

Sequence 1:NP_057953.1 Gene:PAX5 / 5079 HGNCID:8619 Length:391 Species:Homo sapiens
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:398 Identity:151/398 - (37%)
Similarity:194/398 - (48%) Gaps:101/398 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    16 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKP 80
            |.|.||||||||:||||||:.:|.:|||:|..|||||.||||||||||||||||.||.|||||:|
  Fly    20 GQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRP 84

Human    81 GVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQ 145
            ||||||||||.:|::..:|.|.:::||::|:||||::|:.|...|   .||.|||:|::|.    
  Fly    85 GVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFAD---PPSTSSISRLLRG---- 142

Human   146 PPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN 210
                                  |...::.....|:|:||||           .||..|.::    
  Fly   143 ----------------------SDRGSEDGRKDYTINGILG-----------GRDSDISDT---- 170

Human   211 GHSLPGRDFLRKQMRG-DLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGL 274
             .|.||....|||.|. ..||.:|||.|:|.|.|..|.|::|..|..:....||    |.:....
  Fly   171 -ESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTE----ARIQVWF 230

Human   275 DDMKANL--------ASPTPADIGSSVPGPQSYPIVTGRDLASTTLP-GYPPHVPPAGQGS---Y 327
            .:.:|.|        :..:|.:.|||..|       .|..|:..|.| ||    .|.|.||   |
  Fly   231 SNRRARLRKHSGGSNSGLSPMNSGSSNVG-------VGVGLSGATAPLGY----GPLGVGSMAGY 284

Human   328 S-AP--TLTGM-----------VPGSEFS-----GSPYSHPQYSSYN-----DSWRFP----NPG 364
            | ||  |.||.           .|.|..|     .:.:.|.|...|:     ....||    .||
  Fly   285 SPAPGTTATGAGMNDGVHHAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPG 349

Human   365 LLGSPYYY 372
            ..||..||
  Fly   350 HFGSQNYY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX5NP_057953.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 2/4 (50%)
PAX 16..140 CDD:128645 79/123 (64%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 19..75 42/55 (76%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 94..142 19/47 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..218 10/35 (29%)
Pax2_C 279..389 CDD:403565 38/134 (28%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 79/123 (64%)
Homeobox 185..238 CDD:278475 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.