DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX4 and gsb-n

DIOPT Version :9

Sequence 1:NP_001353039.1 Gene:PAX4 / 5078 HGNCID:8618 Length:351 Species:Homo sapiens
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:276 Identity:112/276 - (40%)
Similarity:153/276 - (55%) Gaps:28/276 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     5 GISSMNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEP 69
            |...:|||||:|:||||||...|.:||.:|.||:|||.|||.|:||:|||||||.||..||.:.|
  Fly    20 GQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRP 84

Human    70 KGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQED 134
            ..||||||::.:|.:..||.:|:.|.|::|:|||:.:|..||..   ..||.|||:|:||.  .|
  Fly    85 GVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFA---DPPSTSSISRLLRG--SD 144

Human   135 QGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPG-----TGHRNRTIFSPSQAEALEKEFQRGQY 194
            :|....|   .......:|.......:...:.||     ...|:||.|:..|.||||:.|.|.||
  Fly   145 RGSEDGR---KDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQY 206

Human   195 PDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQS 259
            ||...|.:||..|:|.|..::||||||||:.|:..        .|::.||:.       :::..|
  Fly   207 PDVYTREELAQTTALTEARIQVWFSNRRARLRKHS--------GGSNSGLSP-------MNSGSS 256

Human   260 PGSVPTAALPALEPLG 275
            ...|......|..|||
  Fly   257 NVGVGVGLSGATAPLG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX4NP_001353039.1 PAX 5..129 CDD:128645 65/123 (53%)
Homeobox 174..226 CDD:306543 28/51 (55%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 65/123 (53%)
Homeobox 185..238 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.