DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX3 and Gsc

DIOPT Version :10

Sequence 1:NP_852124.1 Gene:PAX3 / 5077 HGNCID:8617 Length:505 Species:Homo sapiens
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:69 Identity:42/69 - (60%)
Similarity:50/69 - (72%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   214 PLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQA 278
            |.||| ||.||.||.||||:||..|::|||||:..||:||.:..|.|.||:|||.||||:||||.
  Fly   336 PPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQK 399

Human   279 GANQ 282
            ...|
  Fly   400 REEQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX3NP_852124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PAX 34..159 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 37..93
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 113..161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..228 9/13 (69%)
Homeodomain 220..276 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..351
Pax7 347..391 CDD:403540
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 34/55 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.