DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX2 and Poxm

DIOPT Version :9

Sequence 1:NP_003981.3 Gene:PAX2 / 5076 HGNCID:8616 Length:432 Species:Homo sapiens
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:415 Identity:150/415 - (36%)
Similarity:190/415 - (45%) Gaps:102/415 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     8 DPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRY 72
            ||.|.. |.:|.|||||||||||||||:..|.||||||..|:||||||||||||||||||||.||
  Fly     2 DPESQC-PQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARY 65

Human    73 YETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINR 137
            :|||||.||.||||||:|.|||||:.|.|.|:::|.:||||||||||:|||||...|||||||:|
  Fly    66 HETGSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISR 130

Human   138 IIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRK 202
            |:|.|               :.:.||...|.|.   :.|.|:...||.|.||    .::||....
  Fly   131 ILRNK---------------LGSLGHQHTPGTV---MGSGSSSGGGSVSSNG----GQNNGTSAS 173

Human   203 RD-EVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVP---NGDSQSGVDSLRKHLRADTFTQQQLEA 263
            .: .:....:|    |||..|             |   :....:...:...|:.|.......|  
  Fly   174 NNINLSNLGNP----GGGPHH-------------PHHHHHHQSAAAAASAHHVHAHAHAHAHL-- 219

Human   264 LDRVFERPSYPDVFQASEHIKSEQGNEYSLPAL----TPGLDEVKSSLSASTNPELGSNVSGTQT 324
                     |..::|           .||..|.    ||         ..|.:|..|:...|:  
  Fly   220 ---------YNSIYQ-----------PYSAAAAYSMKTP---------CGSPSPPQGAGGQGS-- 253

Human   325 YPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNP 389
                             .||  |....|...:..|...|.|....:..:|.|..|...:.:....
  Fly   254 -----------------VPH--PHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVG 299

Human   390 ALLMPPPGA--PPLPLLPLPMTATS 412
            ...|...|:  .|||:.|.|:..|:
  Fly   300 VGGMGGMGSTVSPLPMTPSPVAGTA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX2NP_003981.3 PAX 16..140 CDD:128645 93/123 (76%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 19..75 45/55 (82%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 94..142 32/47 (68%)
homeodomain 255..>278 CDD:412151 2/22 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..325 4/20 (20%)
Pax2_C 305..>390 CDD:403565 14/84 (17%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 93/122 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.