DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX1 and gsb-n

DIOPT Version :9

Sequence 1:NP_006183.2 Gene:PAX1 / 5075 HGNCID:8615 Length:534 Species:Homo sapiens
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:512 Identity:159/512 - (31%)
Similarity:212/512 - (41%) Gaps:165/512 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    97 QTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSIL 161
            |..|.||||||||:|||||||.|||:|||:|..|:|||.||||||||||||||||.||.|||||.
  Fly    19 QGQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIR 83

Human   162 PGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNK-- 224
            ||.||||||:||:|.:...|.:.::.:|.||:||||::|:.:|..|.   ||.|||||:||..  
  Fly    84 PGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFADP---PSTSSISRLLRGSDR 145

Human   225 --------------IG--------SLAQPGPYEASKQPPSQPTLPYNHI---------YQYP--- 255
                          :|        :.::||.....||..|:.|.....:         .|||   
  Fly   146 GSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVY 210

Human   256 ----YPSPVSPTGAKM----------------GSHPGV-PGTAGH----VSIPRSWPSAHSVSNI 295
                .....:.|.|::                ||:.|: |..:|.    |.:..|..:|......
  Fly   211 TREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMNSGSSNVGVGVGLSGATAPLGYGP 275

Human   296 LGIRTFMEQTGALAGSEGTAYSPK---------MEDWAGVNRTAFPATPAVNGLEKPALEADIKY 351
            ||:       |::||     |||.         |.|  ||:..|.  .|:.:.....|..|...:
  Fly   276 LGV-------GSMAG-----YSPAPGTTATGAGMND--GVHHAAH--APSSHHSAATAAAAAHHH 324

Human   352 TQSASTLSAVGGFLPACAYPASNQHGVYSAPGGGYLAPGPPWPPAQGPPLAPPGAGVAVHGGELA 416
            ||       :||:   ....::.|||.   |||                .|.||     |.|   
  Fly   325 TQ-------MGGY---DLVQSAAQHGF---PGG----------------FAQPG-----HFG--- 352

Human   417 AAMTFKHPSRE-------GSLPAPAARPRTPSVAYTDCPSRPRPPRGSSPRTRARRERQADPGAQ 474
             :..:.|....       ..|.|.:....:||:..:|..|:...|   |..::|.....|:..|.
  Fly   353 -SQNYYHQDYSKLTIDDFSKLTADSVSKISPSLHLSDNYSKLEAP---SNWSQAAYHAAANYNAH 413

Human   475 VC-------AAAPAIGTGRIGGLAEEEASAGPRGARPASPQAQPCLWPDPPHFLYWS 524
            |.       |||.|.|                   .|||..:.|.  |......|||
  Fly   414 VAQHQLNDYAAAAAHG-------------------NPASAYSHPL--PTQGQAKYWS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX1NP_006183.2 PAX 98..225 CDD:238076 81/142 (57%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 101..157 44/55 (80%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 176..224 20/47 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..480 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..511 3/18 (17%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 79/123 (64%)
Homeobox 185..238 CDD:278475 7/52 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.