Sequence 1: | NP_006183.2 | Gene: | PAX1 / 5075 | HGNCID: | 8615 | Length: | 534 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_722629.1 | Gene: | al / 33208 | FlyBaseID: | FBgn0000061 | Length: | 408 | Species: | Drosophila melanogaster |
Alignment Length: | 314 | Identity: | 65/314 - (20%) |
---|---|---|---|
Similarity: | 95/314 - (30%) | Gaps: | 161/314 - (51%) |
- Green bases have known domain annotations that are detailed below.
Human 222 RNKIGSLAQP-GPY----EASKQ-------PPSQPTLPYNHI------------------YQYPY 256
Human 257 PS--PVSPTG-----AKMGSHPGVPGTAGHVSIPRSWPSAHSVSNILGIRTFMEQTGALAGSEGT 314
Human 315 AYSPKMEDWAGVNRTAFP-ATPAVNGLEKPALEADIKYTQSASTLSAVGGFLPACAYPASNQHGV 378
Human 379 YSAPGGGYLAPGPPWPPAQG--------------PPLAPPGAGVAVHGGELA------------- 416
Human 417 ----------AAMTFKH-PSREGSLPAPAARPRTPSVAYTDCPSRPRPPRGSSP 459 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PAX1 | NP_006183.2 | PAX | 98..225 | CDD:238076 | 0/2 (0%) |
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 | 101..157 | ||||
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 | 176..224 | 0/1 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 424..480 | 10/36 (28%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 492..511 | ||||
al | NP_722629.1 | Homeobox | 89..141 | CDD:278475 | |
OAR | 374..391 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |