DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAX1 and al

DIOPT Version :9

Sequence 1:NP_006183.2 Gene:PAX1 / 5075 HGNCID:8615 Length:534 Species:Homo sapiens
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:314 Identity:65/314 - (20%)
Similarity:95/314 - (30%) Gaps:161/314 - (51%)


- Green bases have known domain annotations that are detailed below.


Human   222 RNKIGSLAQP-GPY----EASKQ-------PPSQPTLPYNHI------------------YQYPY 256
            :.|:|..:.| .||    .|:.|       ||:    |:.|:                  ::||:
  Fly   143 QEKVGPQSHPYNPYLPGGAATMQTVVGAALPPN----PFTHLGFQLRKPFDAQHAANLAAFRYPH 203

Human   257 PS--PVSPTG-----AKMGSHPGVPGTAGHVSIPRSWPSAHSVSNILGIRTFMEQTGALAGSEGT 314
            .|  |:.|:|     .:...|....|.||..|     ||: |..::|                  
  Fly   204 LSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYS-----PSS-SFQSLL------------------ 244

Human   315 AYSPKMEDWAGVNRTAFP-ATPAVNGLEKPALEADIKYTQSASTLSAVGGFLPACAYPASNQHGV 378
                       .|.||.| .||    |.||                      ||....:.:.|  
  Fly   245 -----------ANMTAVPRGTP----LGKP----------------------PALLVGSPDLH-- 270

Human   379 YSAPGGGYLAPGPPWPPAQG--------------PPLAPPGAGVAVHGGELA------------- 416
              :|  .::...||..||.|              ||.|||...|.|...:|:             
  Fly   271 --SP--NHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQA 331

Human   417 ----------AAMTFKH-PSREGSLPAPAARPRTPSVAYTDCPSRPRPPRGSSP 459
                      .|:|..| |.|:  ||.|:.:            :.|.|||.::|
  Fly   332 SSLSPTQTSPVALTLSHSPQRQ--LPPPSHQ------------APPPPPRAATP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAX1NP_006183.2 PAX 98..225 CDD:238076 0/2 (0%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 101..157
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 176..224 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..480 10/36 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..511
alNP_722629.1 Homeobox 89..141 CDD:278475
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.