DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNTN3 and cntn2

DIOPT Version :9

Sequence 1:NP_001380305.1 Gene:CNTN3 / 5067 HGNCID:2173 Length:1028 Species:Homo sapiens
Sequence 2:XP_031752703.1 Gene:cntn2 / 100487049 XenbaseID:XB-GENE-6070188 Length:1033 Species:Xenopus tropicalis


Alignment Length:1033 Identity:458/1033 - (44%)
Similarity:636/1033 - (61%) Gaps:29/1033 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     9 ILLSFIGCLGGELLLQ--GPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDIDM 71
            :.|||......|..:.  ||||.::|.|::||.||.::::||.|.||.:||..|||||||:::::
 Frog    13 VFLSFSALKPAESFMSEYGPVFEEQPENTLFPDGSIEEQVTLPCRARASPSATYRWQLNGTELNL 77

Human    72 SMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVRE 136
            :.:..|:|.||||.:..|.::...|||||.|:|..||::|.||.|:|.||:.|..:.|.||.|.|
 Frog    78 TADPSYRLVGGNLAISGPTQSKHAGTYQCIASNPKGTVLSSEASLRFGYLQEFPAEQRDTVKVTE 142

Human   137 GQGVVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVVTSM 201
            |.||:|.|.||.|...|||.|:.||:|:|:..|:||||||.||:||:::....|.|.|:|:.||.
 Frog   143 GWGVMLACNPPKHYPGLSYRWLLNEFPTFLNTDNRRFVSQVTGNLYVAQTVKEDEGAYSCLTTSH 207

Human   202 V--TNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQINWRRS 264
            :  |...|..|.|.|.:.|:.....|.|.|:|:||....|..|..|.|||||.|||:|.|.||:.
 Frog   208 ISFTTKSVYSSFTQLNVNSEVKPRTYAPSIKVRFPGETYALYGQAVFLECFAFGNPVPHIRWRKV 272

Human   265 DG-LPFSSKIKLRKFSGVLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVE 328
            || ||    .:|.....||..|:...|:.|:|||.|.||.|....:||:...|:|.|:.:|.|.|
 Frog   273 DGTLP----PRLLVIDPVLHFPSITFEEDGTYECEAVNSEGSTTHQGRVIVQAQPEWLHVITDTE 333

Human   329 IAVEDSLYWECRASGKPKPSYRWLKNGAALVLEERTQIENGALTISNLSVTDSGMFQCIAENKHG 393
            ..:...|.|.|.|||||:|:.|||::|..|:.:...:|.||.:..::||:.||||:||:||||||
 Frog   334 AKIGSDLLWSCAASGKPRPTIRWLRDGKPLMTQVNIEITNGQIKFTSLSLHDSGMYQCVAENKHG 398

Human   394 LVYSSAELKVVASAPDFSKNPMKKLVQVQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISL 458
            .:|::|||.|.|.||||..:|:|:|:....|..|.:.|.|||:|..|..|.||...:....|:::
 Frog   399 TIYTTAELTVQALAPDFRLSPVKRLIPAARGGEVIIQCNPRAAPTPLILWSKGTELLFNSSRVTV 463

Human   459 LNDGGLKIANVTKADAGTYTCMAENQFGKANGTTHLVVTEPTRITLAPSNMDVSVGESVILPCQV 523
            ..:|.|.:.|::::|.|.|||.|||..||:|.|..|.|.|.|:||||||..|::.|:|:.|.|..
 Frog   464 TANGTLILRNISRSDEGKYTCFAENIMGKSNSTGVLSVREATKITLAPSGSDINQGDSITLQCHA 528

Human   524 QHDPLLDIIFTWYFNGALADFKKDGSHFEKVG-GSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVS 587
            .|||.:|:.|||..||...||:|:..::.:.. ..:.|||.|.|.||:|:|||.||.||.||..|
 Frog   529 SHDPSMDLTFTWTLNGIPIDFEKEAQNYRRTSMDEAVGDLHIINAQLRHAGKYTCMAQTVVDRTS 593

Human   588 SAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGWQTVTTVPEV 652
            :.|.|::||.||||..|.|..:.:|..||||..|.|||||:..|.:|.|.|.:..|::..|.|..
 Frog   594 AMASLLIRGPPGPPGGVVVKYVGETMVQLSWSRGFDNHSPISRYVVQVREPLTEIWRSARTDPPT 658

Human   653 IDGKTHTATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGGGSRSEL 717
            ::|...:|.||.||.|.:|.||:||||.:|.|:||.||..:||.||.|.|.||||.||||:.:||
 Frog   659 VEGNAESALVVGLNQWTDYLFRIVASNILGDGDPSAPSALIRTREAAPNVAPSEVGGGGGAPNEL 723

Human   718 VITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVPYSPYEVKVGVYN 782
            .|.|.|:..:.|||:.|||::||:.....||:...|....:.:||:|||||..|:|::||:..||
 Frog   724 TINWTPIGRQYQNGDDFGYIIAFKRKNENTWLTVRVPGGQSQQYVYRNESIAAYTPFDVKIQGYN 788

Human   783 NKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEVRYWNGGG 847
            .|||||||..|||:||||||.:.||:|.|.::|||:|||:||  |.:...|.|||||:|||....
 Frog   789 KKGEGPFSRDTTVYSAEEEPRMFPSEVKATAISSSDIEVAWN--PVQTLKGVLLGYEIRYWKTSD 851

Human   848 KEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKKTPPSQPPGNVVW 912
            ||.::.:::.||..|:|.:..||.:..||..||.||.||.||.|...||||.|.|.|:.|.|:.|
 Frog   852 KEAAADRVRSAGMATTAHVTSLKPDTTYYVTVRVYNQAGTGPSSPATNVTTSKAPSSKLPENIKW 916

Human   913 NATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDY---IIEV 974
            ..:...:.:.|..|.|::|||.|||||:.||.|..:...:..|:||..|  ||..|.:   .|::
 Frog   917 TLSRKSLSIKWNPVVALQNESSVTGYKILYRMSHHSTPILYVTSKTHIE--LPFPEGFSTVTIQL 979

Human   975 KATTDGGDGTSSEQIRIPRI--TSMDARGSTSAISNVHPMSSYM----PIVLFLIVYV 1026
            :||..||||..:| :.||..  |||....|.|     .|::..:    ..:||||.|:
 Frog   980 RATGKGGDGEPAE-VHIPTDSGTSMMVENSAS-----RPITQTLAAKTTTLLFLIRYL 1031

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNTN3NP_001380305.1 Ig 25..120 CDD:416386 45/94 (48%)
Ig strand A 27..31 CDD:409353 2/3 (67%)
Ig strand A' 34..39 CDD:409353 2/4 (50%)
Ig strand B 45..53 CDD:409353 3/7 (43%)
Ig strand C 58..64 CDD:409353 3/5 (60%)
Ig strand C' 66..69 CDD:409353 1/2 (50%)
Ig strand D 76..80 CDD:409353 1/3 (33%)
Ig strand E 82..88 CDD:409353 3/5 (60%)
Ig strand F 95..104 CDD:409353 6/8 (75%)
Ig strand G 107..120 CDD:409353 7/12 (58%)
Ig 129..214 CDD:416386 42/86 (49%)
Ig strand A 130..135 CDD:409353 2/4 (50%)
Ig strand B 139..145 CDD:409353 3/5 (60%)
Ig strand C 153..159 CDD:409353 4/5 (80%)
Ig strand C' 164..166 CDD:409353 0/1 (0%)
Ig strand D 171..176 CDD:409353 4/4 (100%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 193..201 CDD:409353 3/7 (43%)
Ig strand G 203..214 CDD:409353 4/10 (40%)
Ig 227..315 CDD:416386 39/88 (44%)
Ig strand A 227..232 CDD:409353 2/4 (50%)
Ig strand A' 235..240 CDD:409353 0/4 (0%)
Ig strand B 243..252 CDD:409353 5/8 (63%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand C' 265..267 CDD:409353 2/2 (100%)
Ig strand D 276..279 CDD:409353 0/2 (0%)
Ig strand E 280..285 CDD:409353 2/4 (50%)
Ig strand F 293..301 CDD:409353 5/7 (71%)
Ig strand G 304..315 CDD:409353 3/10 (30%)
Ig 320..403 CDD:416386 39/82 (48%)
Ig strand A' 326..330 CDD:409353 2/3 (67%)
Ig strand B 334..342 CDD:409353 3/7 (43%)
Ig strand C 348..353 CDD:409353 2/4 (50%)
Ig strand C' 355..358 CDD:409353 1/2 (50%)
Ig strand D 363..367 CDD:409353 0/3 (0%)
Ig strand E 369..374 CDD:409353 1/4 (25%)
Ig strand F 383..390 CDD:409353 4/6 (67%)
Ig strand G 394..403 CDD:409353 4/8 (50%)
Ig 408..496 CDD:416386 34/87 (39%)
Ig strand A 408..413 CDD:409353 3/4 (75%)
Ig strand A' 416..421 CDD:409353 2/4 (50%)
Ig strand B 425..432 CDD:409353 1/6 (17%)
Ig strand C 440..444 CDD:409353 1/3 (33%)
Ig strand D 458..461 CDD:409353 0/2 (0%)
Ig strand E 462..467 CDD:409353 2/4 (50%)
Ig strand F 475..483 CDD:409353 5/7 (71%)
Ig strand G 489..496 CDD:409353 3/6 (50%)
Ig 498..598 CDD:416386 47/100 (47%)
Ig strand A 498..504 CDD:409353 3/5 (60%)
Ig strand A' 507..512 CDD:409353 2/4 (50%)
Ig strand B 515..523 CDD:409353 3/7 (43%)
Ig strand C 532..536 CDD:409353 2/3 (67%)
Ig strand E 560..564 CDD:409353 3/3 (100%)
Ig strand F 573..580 CDD:409353 5/6 (83%)
Ig strand G 587..591 CDD:409353 1/3 (33%)
FN3 598..695 CDD:238020 44/96 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..713 18/28 (64%)
FN3 703..795 CDD:238020 45/91 (49%)
FN3 805..898 CDD:238020 43/92 (47%)
FN3 906..991 CDD:238020 32/87 (37%)
cntn2XP_031752703.1 Ig 324..408 CDD:416386 39/83 (47%)
Ig strand A 324..327 CDD:409353 1/2 (50%)
Ig strand A' 331..335 CDD:409353 2/3 (67%)
Ig strand B 339..347 CDD:409353 3/7 (43%)
Ig strand C 353..358 CDD:409353 2/4 (50%)
Ig strand C' 360..363 CDD:409353 1/2 (50%)
Ig strand D 368..372 CDD:409353 0/3 (0%)
Ig strand E 374..379 CDD:409353 1/4 (25%)
Ig strand F 388..395 CDD:409353 4/6 (67%)
Ig strand G 399..408 CDD:409353 4/8 (50%)
Ig5_Contactin 413..501 CDD:409358 34/87 (39%)
Ig strand B 432..436 CDD:409358 1/3 (33%)
Ig strand C 445..449 CDD:409358 1/3 (33%)
Ig strand E 467..471 CDD:409358 2/3 (67%)
Ig strand F 481..486 CDD:409358 3/4 (75%)
Ig strand G 494..497 CDD:409358 1/2 (50%)
Ig 503..601 CDD:416386 45/97 (46%)
Ig strand A 503..509 CDD:409353 3/5 (60%)
Ig strand A' 512..517 CDD:409353 2/4 (50%)
Ig strand B 520..528 CDD:409353 3/7 (43%)
Ig strand C 537..541 CDD:409353 2/3 (67%)
Ig strand D 562..565 CDD:409353 0/2 (0%)
Ig strand E 566..570 CDD:409353 3/3 (100%)
Ig strand F 579..586 CDD:409353 5/6 (83%)
Ig strand G 593..597 CDD:409353 1/3 (33%)
FN3 615..696 CDD:238020 36/80 (45%)
FN3 709..802 CDD:238020 46/92 (50%)
FN3 812..902 CDD:238020 43/91 (47%)
FN3 911..997 CDD:238020 33/88 (38%)
Ig 30..126 CDD:416386 45/95 (47%)
Ig strand A 33..37 CDD:409353 2/3 (67%)
Ig strand A' 40..45 CDD:409353 2/4 (50%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
Ig strand C 64..70 CDD:409353 3/5 (60%)
Ig strand C' 72..75 CDD:409353 1/2 (50%)
Ig strand D 82..86 CDD:409353 1/3 (33%)
Ig strand E 88..94 CDD:409353 3/5 (60%)
Ig strand F 101..110 CDD:409353 6/8 (75%)
Ig strand G 113..126 CDD:409353 7/12 (58%)
Ig 134..223 CDD:416386 42/88 (48%)
Ig strand A 136..141 CDD:409353 2/4 (50%)
Ig strand B 145..151 CDD:409353 3/5 (60%)
Ig strand C 159..165 CDD:409353 4/5 (80%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand D 177..182 CDD:409353 4/4 (100%)
Ig strand E 185..189 CDD:409353 2/3 (67%)
Ig strand F 199..207 CDD:409353 3/7 (43%)
Ig strand G 209..223 CDD:409353 4/13 (31%)
Ig 235..320 CDD:416386 39/88 (44%)
Ig strand A 235..240 CDD:409353 2/4 (50%)
Ig strand A' 243..248 CDD:409353 0/4 (0%)
Ig strand B 251..260 CDD:409353 5/8 (63%)
Ig strand C 266..270 CDD:409353 1/3 (33%)
Ig strand C' 273..275 CDD:409353 1/1 (100%)
Ig strand D 281..284 CDD:409353 0/2 (0%)
Ig strand E 285..290 CDD:409353 2/4 (50%)
Ig strand F 298..306 CDD:409353 5/7 (71%)
Ig strand G 309..320 CDD:409353 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D292460at33208
OrthoFinder 1 1.000 - - FOG0000550
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X342
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.