DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAK3 and hpo

DIOPT Version :9

Sequence 1:NP_001121640.1 Gene:PAK3 / 5063 HGNCID:8592 Length:580 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:325 Identity:121/325 - (37%)
Similarity:190/325 - (58%) Gaps:21/325 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   246 IASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKI 310
            ::.|.|.:  |....:.|.:||..:      .|..|:::|.:|:         .|:|.:....|:
  Fly     1 MSEPEVTS--VVDMKSPNISSSCSF------FKLKKLSEESLLQ---------PPEKVFDIMYKL 48

Human   311 GQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELW 375
            |:|:.|:||.|:...:...||||.:.::....:  ||.||.:|::..:|.:|.|..||....:||
  Fly    49 GEGSYGSVYKAVHKESSSIVAIKLVPVESDLHE--IIKEISIMQQCDSPYVVRYYGSYFKQYDLW 111

Human   376 VVMEYLAGGSLTDV--VTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVK 438
            :.|||...||::|:  :.:..:.|.:||.:..:.||.|.:||..:.||||||:.||||..:|..|
  Fly   112 ICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAK 176

Human   439 LTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENP 503
            |.|||...|:|...:||:|::|||:||||||:....|....|||||||.|:||.||:|||...:|
  Fly   177 LADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHP 241

Human   504 LRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLI 568
            :||:::|.....|..:.|:|.|..|.||:::||..:.|.|.:|.|||:|.|::.||..|.|.|::
  Fly   242 MRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPML 306

Human   569  568
              Fly   307  306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAK3NP_001121640.1 PBD 69..162 CDD:307091
STKc_PAK3 284..580 CDD:132987 113/287 (39%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 105/256 (41%)
S_TKc 42..293 CDD:214567 103/252 (41%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.