DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5F1B and Jarid2

DIOPT Version :9

Sequence 1:NP_001677.2 Gene:ATP5F1B / 506 HGNCID:830 Length:529 Species:Homo sapiens
Sequence 2:NP_648324.1 Gene:Jarid2 / 39103 FlyBaseID:FBgn0036004 Length:2351 Species:Drosophila melanogaster


Alignment Length:444 Identity:84/444 - (18%)
Similarity:139/444 - (31%) Gaps:84/444 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 AAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSP----KAGAATGRIVAVIGA 69
            |.|.||.|..:...:|:.||..:.....|.::.|     :::||:|    |..|..|:..|..|.
  Fly  1357 AKAAASKAATQPRSTAATPPTPISSTPTPASLTP-----SKSSPTPPPAVKQKAEKGKRNATAGG 1416

Human    70 ---------VVDVQFDEGLPPILNALEVQGRETRLVLEVAQH--LGESTVR----TIAMDGTEGL 119
                     ......:....|:.|....:.::.:...:.|.:  .|..|.|    ....|...|.
  Fly  1417 GATALASPPAAPTPANPKRTPVYNQKNAKAQQQQAETKPASNPPSGAGTKRESVYAFGKDDESGS 1481

Human   120 VRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILV 184
            ..|.:.....:|:..|.          ::...:.||.|.|.:..|...|.|.: :.:|..:...:
  Fly  1482 KSGNRRRTDPSPVPAPA----------LVPNALSERSPTKKRAAAAAAATAVQ-LTLSPTENCKI 1535

Human   185 TGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHE 249
            .|   ....||..:|.|                 .....|.|.....|.|. |:...||...|..
  Fly  1536 EG---KPSKAPTGRGAK-----------------KQQQQAPAPPAPPVEAS-GDSDAEGATFYIP 1579

Human   250 MIESGVINLKD-ATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQ-------------- 299
            :..:||....| ....||:..|: ..|.|...:|.:....|.:...|...:              
  Fly  1580 LQGAGVGGSGDGGIQGVAVKLGR-EGPDGPNQKVVMQATLVTKAQMDTNSKPLPESLNTNELVKT 1643

Human   300 -------DVLLFIDNIFRFTQAGSEVSALLGRIPSA---VGYQPTLATDMGTMQERITTTKKGSI 354
                   |......::....:|.:..:|.....|.|   |......:...|:.:.| |..:..|.
  Fly  1644 LLHAASNDAASTTTSLKSLPKASTSAAAGAAAAPGASSLVRVNSNSSLFSGSAKSR-TAAQTSST 1707

Human   355 TSVQAIYVPADDLTDPAPATTF-AHLDATTVLSRAIAELGIYPAVDPLDSTSRI 407
            .:..|.....|.....|..|.| .|.|.|.::...|.........||::...||
  Fly  1708 AAAVAKKYKDDTPIKMANNTAFPRHDDPTQMVEAPIFRPTEKEFADPIEFIERI 1761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5F1BNP_001677.2 PRK09280 58..524 CDD:236447 70/391 (18%)
Jarid2NP_648324.1 JmjN 1740..1781 CDD:128818 5/22 (23%)
ARID 1812..1893 CDD:279697
JmjC 2066..2181 CDD:202224
zf-C5HC2 2281..2334 CDD:280996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.