DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAK1 and hpo

DIOPT Version :9

Sequence 1:NP_001122092.1 Gene:PAK1 / 5058 HGNCID:8590 Length:553 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:302 Identity:111/302 - (36%)
Similarity:177/302 - (58%) Gaps:21/302 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   244 KKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPK 308
            |..|:|:|.:|:         .|:|.:....|:|:|:.|:||.|:...:...||||.:.::....
  Fly    25 KLKKLSEESLLQ---------PPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLH 80

Human   309 KELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDV--VTETCMDEGQIAAVCR 371
            :  ||.||.:|::..:|.:|.|..||....:||:.|||...||::|:  :.:..:.|.:||.:..
  Fly    81 E--IIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILS 143

Human   372 ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVV 436
            :.||.|.:||..:.||||||:.||||..:|..||.|||...|:|...:||:|::|||:||||||:
  Fly   144 DTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI 208

Human   437 TRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRC 501
            ....|....|||||||.|:||.||:|||...:|:||:::|.....|..:.|::.|..|.||:::|
  Fly   209 EEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKC 273

Human   502 LEMDVEKRGSAKELLQ---VRKLRFQVFSNFSMIAASIPEDC 540
            |..:.:.|.:|.|||:   :|..:.:     |::...:.|.|
  Fly   274 LVKEPDDRATATELLEHEFIRNAKHR-----SILKPMLEETC 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAK1NP_001122092.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Autoregulatory region 70..140
PBD 74..128 CDD:334253
GTPase-binding 75..105
Interaction with CRIPAK. /evidence=ECO:0000269|PubMed:16278681 132..270 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..251 3/6 (50%)
STKc_PAK_I 262..517 CDD:270814 101/256 (39%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 102/256 (40%)
S_TKc 42..293 CDD:214567 100/252 (40%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.