DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINE1 and nec

DIOPT Version :9

Sequence 1:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:410 Identity:115/410 - (28%)
Similarity:188/410 - (45%) Gaps:50/410 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    25 HHPP---SYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMG 86
            :.||   ||:...:|:    :|:::.::...:||||||:.|.::||::...:.|:|.:::|.|..
  Fly    98 NRPPPVFSYMDRFSSE----LFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGE 158

Human    87 FKIDDKGMAPALRHLY---KELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRL-FRSTVKQV 147
            |..:...:|.....:.   |.|.|.    :::....::..|:|..|......:.:. |.:..:.|
  Fly   159 FSKNAMAVAQDFESVIKYKKHLEGA----DLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAV 219

Human   148 DFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLF 212
            |....:.....||.||...|:..|.:|:....||..|:.:||||:||.|:|:..|....|....|
  Fly   220 DMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDF 284

Human   213 HKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNIL 277
            ..::|....|.||...:.:...|......   ..|||.|.....||.|..|.|    .:.|..:|
  Fly   285 QHTNGRISKVAMMFNDDVYGLAELPELGA---TALELAYKDSATSMLILLPNE----TTGLGKML 342

Human   278 SAQLISHWKGNMTRLPRLL-------VLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSDQ 335
              |.:|..:.::.|:...|       .||||..|.|.|:.:||:|||:..||.. .:..|.|.||
  Fly   343 --QQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTP-NSQVTKLMDQ 404

Human   336 EPLHVAQALQKVKIEVNESGTVASSST---AVIVSARMAPEEIIMDRPFLFVVRHNPTGPLQDGT 397
             |:.|::.|||..|.|.|:||.||:::   .|.:|....|.|.:.:|||:|.||           
  Fly   405 -PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR----------- 457

Human   398 TGLTGAFVCLVETISVPVTL 417
               |.|.|..:..:..|..:
  Fly   458 ---TPASVLFIGHVEYPTPM 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 109/377 (29%)
necNP_524851.1 SERPIN 108..468 CDD:238101 110/392 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.