DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINE1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:375 Identity:97/375 - (25%)
Similarity:175/375 - (46%) Gaps:36/375 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    37 DFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAA--MGFKIDDKGMAPALR 99
            ||.:.:.:|:.:.....|:.|||:...:.|.:...::..:|::::..|  :|:.::.:.:..:..
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104

Human   100 HLYKELMGPWNKD--EISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDF-SEVERARFIIND 161
            ...::....|.:.  |:|:.:.|||.|.:.:..    .|..|.....|::|| ::.|.....|||
  Fly   105 LAQRQDEFRWRQSPMELSSANRIFVDRTINVSN----KFNTLLYGATKELDFKNDPETGLKEIND 165

Human   162 WVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMA 226
            |:...|...|.::|....:...|.|||.||.|..|||.:.|....|..:.|..::.....|.||.
  Fly   166 WIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH 230

Human   227 QTNKFNYTEFTTPDGHYYDILELPY---------HGDT------LSMFIAAPYEKEVPLSALTNI 276
            :|..|   :.|..:|....|::|||         |..|      :||.|..|...::.|:.:.:.
  Fly   231 KTGAF---KMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISR 292

Human   277 LSAQLISHWKGNMTRLPRL--LVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSL-SDQEPL 338
            |:|..:..|...  .||:.  |.||||..|..::|...|..:|:..||.: .|.|..| :|...|
  Fly   293 LNADSVKKWFER--ALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NATFGDLTADPISL 354

Human   339 HVAQALQKVKIEVNESGTVASSSTAVIV---SARMAPEEIIMDRPFLFVV 385
            .:..|....||:|:|.|:.|:::|.::|   |.:..|.:...:.||:|::
  Fly   355 VIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 97/375 (26%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 97/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.