DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRDX1 and Jafrac1

DIOPT Version :9

Sequence 1:NP_001189360.1 Gene:PRDX1 / 5052 HGNCID:9352 Length:199 Species:Homo sapiens
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:185 Identity:135/185 - (72%)
Similarity:154/185 - (83%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    11 PAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIG 75
            |||.|..|||: :|.||||.||||||||:|.|||||||||||||||||||:.|.||:|:||:|||
  Fly     7 PAPAFAGTAVV-NGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIG 70

Human    76 ASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR 140
            .|.||.|.||||:|||:||||||.|:|||::|....:|:|||||..:.||.||||||||||..||
  Fly    71 CSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLR 135

Human   141 QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195
            |||||||||||||:||||||||||:|||:||||||.||||..|:..|..||||||
  Fly   136 QITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRDX1NP_001189360.1 PRX_Typ2cys 8..180 CDD:239313 125/168 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..199 12/20 (60%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 125/168 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I3037
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 283 1.000 Inparanoid score I2876
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR10681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1558
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.