DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRDX1 and Jafrac2

DIOPT Version :9

Sequence 1:NP_001189360.1 Gene:PRDX1 / 5052 HGNCID:9352 Length:199 Species:Homo sapiens
Sequence 2:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster


Alignment Length:192 Identity:126/192 - (65%)
Similarity:152/192 - (79%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     6 AKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN 70
            |.|..|||.|:.|||: :.:...:|||.|.|||||..||||||||||||||||||||..||||:.
  Fly    50 AVISKPAPQFEGTAVV-NKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIK 113

Human    71 CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDD 135
            .:|||.||||||.||||:|||:|:||||.:.|||:||....|::||||.....|.:.|||||||.
  Fly   114 TEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQ 178

Human   136 KGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSK 197
            .|:|||||:||||||||||||:|||||||:||.|||||||||:||:|||.|:.::..:||:|
  Fly   179 TGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRDX1NP_001189360.1 PRX_Typ2cys 8..180 CDD:239313 116/171 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..199 11/22 (50%)
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 116/171 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.