DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6115 and ETFRF1

DIOPT Version :9

Sequence 1:NP_001286001.1 Gene:CG6115 / 50459 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001001660.2 Gene:ETFRF1 / 144363 HGNCID:27052 Length:90 Species:Homo sapiens


Alignment Length:84 Identity:42/84 - (50%)
Similarity:64/84 - (76%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVE 66
            :.||.:|:.|||:|.||||:||  .|...|:|::.:.|:.:||.::|:||..|:|||.::.||:|
Human     5 NSLRGEVLKLYKNLLYLGRDYP--KGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELE 67

  Fly    67 ALYSLKKYRSVKQRYSYND 85
            |||.|:|||::|||| |:|
Human    68 ALYFLRKYRAMKQRY-YSD 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR_ETFRF1_LYRM5 5..80 CDD:380760 36/74 (49%)
ETFRF1NP_001001660.2 Complex1_LYR_ETFRF1_LYRM5 22..81 CDD:380760 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148395
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CK7Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5148
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53295
OrthoDB 1 1.010 - - D1606295at2759
OrthoFinder 1 1.000 - - FOG0006215
OrthoInspector 1 1.000 - - oto88606
orthoMCL 1 0.900 - - OOG6_105048
Panther 1 1.100 - - LDO PTHR21024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4044
SonicParanoid 1 1.000 - - X4490
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.