DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6115 and Etfrf1

DIOPT Version :9

Sequence 1:NP_001286001.1 Gene:CG6115 / 50459 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:XP_002729485.1 Gene:Etfrf1 / 100361188 RGDID:2320673 Length:86 Species:Rattus norvegicus


Alignment Length:84 Identity:41/84 - (48%)
Similarity:65/84 - (77%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVE 66
            :.||.:|::|||:|.||||:||  .|...|::::.:.|:.:||.:||:||..|:|:|.::.||:|
  Rat     3 NSLRGEVLTLYKNLLYLGRDYP--KGADYFKRRLKNVFLKNKDVKDPEKIKELIARGEFVMKELE 65

  Fly    67 ALYSLKKYRSVKQRYSYND 85
            |||.|:|||::|||| |:|
  Rat    66 ALYFLRKYRAMKQRY-YSD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR_ETFRF1_LYRM5 5..80 CDD:380760 35/74 (47%)
Etfrf1XP_002729485.1 Complex1_LYR_ETFRF1_LYRM5 6..79 CDD:380760 35/74 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342305
Domainoid 1 1.000 54 1.000 Domainoid score I11001
eggNOG 1 0.900 - - E1_2CK7Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5055
OMA 1 1.010 - - QHG53295
OrthoDB 1 1.010 - - D1606295at2759
OrthoFinder 1 1.000 - - FOG0006215
OrthoInspector 1 1.000 - - oto95737
orthoMCL 1 0.900 - - OOG6_105048
Panther 1 1.100 - - LDO PTHR21024
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4490
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.