DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6115 and etfrf1

DIOPT Version :9

Sequence 1:NP_001286001.1 Gene:CG6115 / 50459 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:XP_031754302.1 Gene:etfrf1 / 100135114 XenbaseID:XB-GENE-5752833 Length:89 Species:Xenopus tropicalis


Alignment Length:82 Identity:42/82 - (51%)
Similarity:61/82 - (74%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVEAL 68
            ||.:|:.|||:|.:||||||  .|...||:::..||:.:||.:||:||..|:.:|.::.||:|||
 Frog     7 LRGEVVRLYKNLLFLGREYP--KGESYFRERLKRAFLKNKDVRDPEKIKELIGRGEFVIKELEAL 69

  Fly    69 YSLKKYRSVKQRYSYND 85
            |.|:|||::|||| |.|
 Frog    70 YFLRKYRAMKQRY-YED 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR_ETFRF1_LYRM5 5..80 CDD:380760 36/74 (49%)
etfrf1XP_031754302.1 Complex1_LYR_ETFRF1_LYRM5 8..81 CDD:380760 36/74 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12221
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606295at2759
OrthoFinder 1 1.000 - - FOG0006215
OrthoInspector 1 1.000 - - oto102480
Panther 1 1.100 - - LDO PTHR21024
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.