DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and SPBC26H8.16

DIOPT Version :9

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001343086.1 Gene:SPBC26H8.16 / 9407048 PomBaseID:SPBC26H8.16 Length:100 Species:Schizosaccharomyces pombe


Alignment Length:125 Identity:40/125 - (32%)
Similarity:56/125 - (44%) Gaps:29/125 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSCRALI-SQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREKL 66
            |:.||:| ......|.||  ...|.|||:      .||.     .||...:|:.        ::|
pombe     4 RNLRAVILKNYNKALTRC--LHDAGNLKR------PTPP-----RLPKEQQEEW--------DRL 47

  Fly    67 RSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            :.|:...|:      ....:|..|.:..:.||.||||||... |||.:||:..:||||||
pombe    48 QKESSKRPV------DVMRREKHKDFEGDVNPKTGEIGGPKS-EPTVHGDYSYEGRVTDF 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 19/44 (43%)
SPBC26H8.16NP_001343086.1 DUF1674 60..100 CDD:311723 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3596
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.