DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and SDH8

DIOPT Version :9

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_009828.2 Gene:SDH8 / 852572 SGDID:S000000473 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:27/99 - (27%)
Similarity:45/99 - (45%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKPW 92
            |.:::.||.|   ..||:.......::.:.:....|.|....:||....:.........:.:..:
Yeast    44 LPREEQEEFE---RLQRIATSQEAIDQYNAQATGDRTKESLNSPLLTKNDIGSFSPEFSKTIPEF 105

  Fly    93 PNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            ..:.||.|||:||.. .:|.|:||:...||||||
Yeast   106 EGDVNPKTGEVGGPK-QDPLRHGDYSFNGRVTDF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 15/44 (34%)
SDH8NP_009828.2 DUF1674 <103..138 CDD:400311 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.