DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and AT5G67490

DIOPT Version :9

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_569049.1 Gene:AT5G67490 / 836885 AraportID:AT5G67490 Length:108 Species:Arabidopsis thaliana


Alignment Length:99 Identity:35/99 - (35%)
Similarity:43/99 - (43%) Gaps:25/99 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHE-KEPLKPWPN-------------------- 94
            |...:|.|:|....:..|..  .|.|..||.|..: ...:||..|                    
plant    12 PSRSVSSRFLEPVSRFLSSG--TPPPPQAPSPNQDLNRDVKPDQNLQQNLQMQKEEEEEGEGGGG 74

  Fly    95 --NTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
              ..|..||||||..|||||||||||::||.:||
plant    75 GEFVNEDTGEIGGPRGPEPTRYGDWEQRGRCSDF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 24/67 (36%)
AT5G67490NP_569049.1 DUF1674 <78..108 CDD:400311 20/29 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3959
eggNOG 1 0.900 - - E1_KOG3245
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm2537
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28524
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.970

Return to query results.
Submit another query.