DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and Sdhaf4

DIOPT Version :9

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_003750718.1 Gene:Sdhaf4 / 685888 RGDID:1588998 Length:121 Species:Rattus norvegicus


Alignment Length:130 Identity:46/130 - (35%)
Similarity:58/130 - (44%) Gaps:44/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREKLR 67
            ||.|.|    |..|...||.|.:|.                  |..|.|.::..|         :
  Rat    30 RSARLL----GSSLLNHSLRKKSSQ------------------EGKPEPSKQALK---------K 63

  Fly    68 SEAP------LEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            |:.|      |:..||       |::||:.:|::.||.|.|.||..|||||||||||||||..||
  Rat    64 SKLPVGRFDSLDDSPE-------ERDPLQKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 121

  Fly   127  126
              Rat   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 25/44 (57%)
Sdhaf4XP_003750718.1 DUF1674 79..121 CDD:285179 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350517
Domainoid 1 1.000 69 1.000 Domainoid score I9428
eggNOG 1 0.900 - - E1_KOG3245
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5155
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm45132
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28524
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.