DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and SDHAF4

DIOPT Version :9

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_660310.2 Gene:SDHAF4 / 135154 HGNCID:20957 Length:108 Species:Homo sapiens


Alignment Length:56 Identity:35/56 - (62%)
Similarity:40/56 - (71%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LPE---CAPHPAH-EKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            |||   .||..:| |||||:.:|::.||.|.|.||..|||||||||||||||..||
Human    53 LPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 28/45 (62%)
SDHAF4NP_660310.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..108 33/54 (61%)
DUF1674 66..108 CDD:400311 27/41 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156598
Domainoid 1 1.000 70 1.000 Domainoid score I9553
eggNOG 1 0.900 - - E1_KOG3245
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5295
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm40996
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.