DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and CG42486

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster


Alignment Length:73 Identity:43/73 - (58%)
Similarity:57/73 - (78%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLTLLLVLGLLIALFAGSSEGSYCPCDLKTKGTQVCGSNGVTFKNRCEFECSQRDYKKLGRTL 65
            ||:|.::.:||||...|..|||.|||||:|:.  .:|||:||||::|||.|||:||:|:||||.|
  Fly     1 MKFLAMMALLGLLAIFFVSSSEASYCPCNLRK--AEVCGTNGVTYQNRCVFECTQREYRKLGRIL 63

  Fly    66 NIRKDGPC 73
            ||:|.|.|
  Fly    64 NIKKMGSC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052 25/35 (71%)
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 28/45 (62%)

Return to query results.
Submit another query.