powered by:
Protein Alignment CG14933 and CG42486
DIOPT Version :9
Sequence 1: | NP_001285852.1 |
Gene: | CG14933 / 50442 |
FlyBaseID: | FBgn0040968 |
Length: | 77 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001162960.1 |
Gene: | CG42486 / 8673962 |
FlyBaseID: | FBgn0259989 |
Length: | 77 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 43/73 - (58%) |
Similarity: | 57/73 - (78%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKYLTLLLVLGLLIALFAGSSEGSYCPCDLKTKGTQVCGSNGVTFKNRCEFECSQRDYKKLGRTL 65
||:|.::.:||||...|..|||.|||||:|:. .:|||:||||::|||.|||:||:|:||||.|
Fly 1 MKFLAMMALLGLLAIFFVSSSEASYCPCNLRK--AEVCGTNGVTYQNRCVFECTQREYRKLGRIL 63
Fly 66 NIRKDGPC 73
||:|.|.|
Fly 64 NIKKMGSC 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45442203 |
Domainoid |
1 |
1.000 |
42 |
1.000 |
Domainoid score |
I12366 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
45 |
1.000 |
Inparanoid score |
I5496 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000146 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X147 |
|
6 | 5.890 |
|
Return to query results.
Submit another query.