DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and CG42486

DIOPT Version :9

Sequence 1:NP_001285852.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster


Alignment Length:73 Identity:43/73 - (58%)
Similarity:57/73 - (78%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLTLLLVLGLLIALFAGSSEGSYCPCDLKTKGTQVCGSNGVTFKNRCEFECSQRDYKKLGRTL 65
            ||:|.::.:||||...|..|||.|||||:|:.  .:|||:||||::|||.|||:||:|:||||.|
  Fly     1 MKFLAMMALLGLLAIFFVSSSEASYCPCNLRK--AEVCGTNGVTYQNRCVFECTQREYRKLGRIL 63

  Fly    66 NIRKDGPC 73
            ||:|.|.|
  Fly    64 NIKKMGSC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_001285852.1 KAZAL_FS <37..73 CDD:294071 25/35 (71%)
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:294071 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442203
Domainoid 1 1.000 42 1.000 Domainoid score I12366
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5496
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X147
65.890

Return to query results.
Submit another query.